HIV Databases HIV Databases home HIV Databases home
HIV sequence database



>CONSENSUS_B(190) menrwqvmiVWqvdRmrIrtwksLVkhhmyisgkakgwfyrhHyesthPrissevhIPlgdarlvitTyw GlhtgerdwhlgqgvsiewrkrrystqvdpdladqLIHlyyfdcfsesAirnailghivsprCeyqaGHn kvgslqYLALaalitpkkikPPlPsvtkltEdrwNkpqktkghrgshtmngh? >CONSENSUS_C(40) MENRwQvliVwQVDRMkIrTWnSLvKhHmy?SrrangWfYrhHyesRhPkvSsEVHIPlGeArLvikTYw glqtgErdWHLGhgvSIEWrlrrysTqvdPgLADqLIHmhyFdCFadSAIrkAiLghivipRCdYqAghn kvGSLQYLALTAliKPkkiKPPLPSvrKLvEDrwNkpqktrgrrGnhtmnGH$ >B.FR.83.HXB2 MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLVITTYW GLHTGERDWHLGQGVSIEWRKKRYSTQVDPELADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHN KVGSLQYLALAALITPKKIKPPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH$
last modified: Thu Aug 16 15:45 2007


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health