HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

DLNTMLNTVGGHQAAMQMLKETINEEAAEWDR Gag(183-214) human epitope
        VGGHQAAMQMLKDTI Gag(191-205) H-2Dd mouse epitope
        VGGHQAAMQMLKDTI Gag(191-205) human epitope
        VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) mouse epitope
        VGGHQAAMQMLKdTINEEAAEWDR Gag(191-214) subtype-specific susceptible form
        VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) human, macaque epitope
        VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) macaque epitope
        VGGHQAAMQMLKDTINEEAAEWDR Gag(191-214) human, macaque epitope
         GGHQAAMQMLKDTIN Gag(192-206) human epitope
         GGHQAAMQMLKDTINEEEA Gag(192-210) human epitope
          GHQAAMQMLKETINE Gag(193-207) A2, B15 human epitope
          GHQAAMQMLKETINE Gag(193-207) H-2d transgenic mouse epitope
          GHQAAMQMLKETINE Gag(193-207) human epitope
          GHQAAMQMLKETINE Gag(193-207) mouse epitope
          GHQAAMQMLKETINEEAA Gag(193-210) human epitope
          GHQAAMQMLKdTINEEAA Gag(193-210) subtype-specific susceptible form
          GHQAAMQMLKETINEEAAEW Gag(193-212) human epitope
          GHQAAMQMKETINEEAAEW Gag(193-212) human epitope
          GHQAAMQMLKETINEEAAEWDR Gag(193-214) B52 human epitope
           HQAAMQMLKETINE Gag(194-207) human epitope
             AAMQMLKDTINEEAA Gag(196-210) human epitope
             AAMQMLKDTINEEAA Gag(196-210) human epitope
             AAMQMLKETINEEAAEW Gag(196-212) human epitope
              AMQMLKETI Gag(197-205) A2 human epitope
              AMQMLKETI Gag(197-205) H-2Dd mouse epitope
              AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
              AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
              AMQMLKeTI Gag(197-205) diminished response
              AMQiLKDTI Gag(197-205) diminished response
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
              AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
              AMefLKDTa Gag(197-205) diminished HLA binding or increased off-rate
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2Kd mouse epitope
              AMQMLKETI Gag(197-205) H-2d human, mouse epitope
              AMQMLKETI Gag(197-205) H-2d mouse epitope
              ANQMLKDTI Gag(197-205) H-2d mouse epitope
              ANQMLKeTI Gag(197-205) subtype-specific susceptible form
              AMQMLKETI Gag(197-205) H-2d mouse epitope
              AMQMLKETI Gag(197-205) H-2d mouse epitope
              AMQMLKDTI Gag(197-205) H-2d mouse epitope
              AMQMLKETI Gag(197-205) H-2d mouse epitope
              AMQMLKETI Gag(197-205) H-2kd mouse epitope
              AMQMLKETI Gag(197-205) H-2kd mouse epitope
              AMQMLKETI Gag(197-205) human epitope
              AMQMLKDTI Gag(197-205) human, mouse epitope
              AMQMLKeTI Gag(197-205)
              AMQMLKDTI Gag(197-205) human epitope
              AMQMLKDTI Gag(197-205) human epitope
              AMQMLKDTI Gag(197-205) mouse epitope
              AMQILKDTI Gag(197-205) mouse epitope
              AMQMLKETI Gag(197-205) human, mouse epitope
              AMQMLKdTI Gag(197-205) diminished response
              AMQMLKETI Gag(197-205) mouse epitope
              AMQMLKDTI Gag(197-205) mouse epitope
              AMQMLKETI? Gag(197-205) mouse epitope
              AMQMLKETI Gag(197-205) mouse epitope
              AMQMLKETI Gag(197-205) epitope
              AMQMLKETINEEAAE Gag(197-211) B40 human epitope
              AMQMLKETINEEAAE Gag(197-211) H-2d transgenic mouse epitope
              AMQMLKETINEEAAE Gag(197-211) mouse epitope
               MQMLKETI Gag(198-205) B*52:01 human epitope
               MQMLKdTI Gag(198-205) non-susceptible form; observed variant
               MQiLKETI Gag(198-205) observed variant; susceptible form
               MQMLKETI Gag(198-205) B*52:01 human epitope
               MQMLKETI Gag(198-205) B*52:01 human epitope
               MQMLKETI Gag(198-205) B*52:01 human epitope
               MQMLKDTI Gag(198-205) B*52:01 human, mouse epitope
               MQMLKeTI Gag(198-205)
               MQMLKETI Gag(198-205) B*52:01 human, mouse epitope
               MQMLKdTI Gag(198-205)
               MQMLKDTINEEAAE Gag(198-211) human epitope
               MQMLKeTINEEAAE Gag(198-211) subtype-specific susceptible form
               KQMLKDTINEEAAEWD Gag(198-213) human epitope
               KQMLKDTINEEAEEWD Gag(198-213) human epitope
                QMLKDTINEEA Gag(199-209) B*52:01 human, mouse epitope
                QMLKeTINEEA Gag(199-209)
                QMLKETINEEA Gag(199-209) B*52:01 human epitope
                QMLKETINEEA Gag(199-209) B*52:01 human, mouse epitope
                QMLKdTINEEA Gag(199-209)
                 MLKDTINEEAAEWDR Gag(200-214) human epitope
                 MLKDTINEEAAEWDR Gag(200-214) human epitope
                 MLKDTINEEAAEWDR Gag(200-214) human epitope
                  LKETINEEAAEWDR Gag(201-214) human epitope
                  LKETINEEAAEWDRV Gag(201-215) A25 human epitope
                  LKETINEEAAEWDRL Gag(201-215) H-2d transgenic mouse epitope
                  LKDTINEEAAEWDRLHPV Gag(201-218) A*68:01 human epitope
                  LKETINEEAAEWDRLHPV Gag(201-218) human epitope
                  LKETINEEAAEWDRLHPV Gag(201-218) human epitope
                  LKdTINEEAAEWDRLHPV Gag(201-218) subtype-specific susceptible form
                  LKETINEEAAEWDRVPV Gag(201-218) human epitope
                   KETINEEAA Gag(202-210) A*24 human epitope
                   KETINEEAA Gag(202-210) B*08 human epitope
                   KETINEEAA Gag(202-210) B*35:02, B*35:03, B*53:01 human epitope
                   KETINEEAA Gag(202-210) B*40 human epitope
                   KETINEEAA Gag(202-210) B*40 human, mouse epitope
                   KdTINEEAA Gag(202-210) observed variant; susceptible form
                   KDTINEEAA Gag(202-210) B*40 human, mouse epitope
                   KeTINEEAA Gag(202-210) observed variant; susceptible form
                   KETINEEAA Gag(202-210) B*40 human epitope
                   KETINEEAA Gag(202-210) B40 human epitope
                   KETINEEAA Gag(202-210) B*40:02 human epitope
                   KETINEEAA Gag(202-210) B*40:02 human epitope
                   KETINEEAA Gag(202-210) human epitope
                   KETINEEAA Gag(202-210) human epitope
                   KDTINEEAAEWDRL Gag(202-215) human epitope
                    ETINEEAAEW Gag(203-212) A*25 human epitope
                    ETINEEAAEW Gag(203-212) A*25 human epitope
                    ETINEEAAEW Gag(203-212) A*25 human epitope
                    ETINEEAAEW Gag(203-212) A*25 human epitope
                    ETINdEAAEW{DRl} Gag(203-212) diminished response; escape documented in this paper; observed variant; processing
                    ETINdEAAEW{DRV} Gag(203-212) observed variant; replicative capacity reduced; susceptible form
                    ETINEEAAEW{DRl} Gag(203-212) observed variant; replicative capacity is not abrogated; susceptible form
                    ETINEEAAEW Gag(203-212) A*25 human epitope
                    EIINEEAAEW Gag(203-212) A*25 human epitope
                    ETINEEAAEW Gag(203-212) A*25 human epitope
                    ETINEEAAEW Gag(203-212) A25 human epitope
                    ETINEEAAEW Gag(203-212) A25 human epitope
                    ETINEEAAEW Gag(203-212) A25 human epitope
                    ETINdEAAEW Gag(203-212) susceptible form
                    ETINEEAAEW Gag(203-212) A25 human epitope
                    ETINEEAAEW Gag(203-212) A25, B53 human epitope
                    ETINEEAAEW Gag(203-212) A*25:01 human epitope
                    ETINdEAAEW Gag(203-212) diminished response
                    ETINEEAAAEW Gag(203-212) A*25:01 human epitope
                    ETINEEAAEW Gag(203-212) A*25:01 human epitope
                    ETINdEAAEW Gag(203-212) diminished response
                    ETINEEAAEW Gag(203-212) A*25:01 human epitope
                    ETINEEAAEW Gag(203-212) A*25:01 human epitope
                    ETINEEAAEW Gag(203-212) A*25:01 human epitope
                    ETINEEAAEW Gag(203-212) A*25:01 human epitope
                    ETINEEAAEW Gag(203-212) A*25:01 human epitope
                    dTINEEAAEW Gag(203-212) observed variant
                    ETINEEAAEW Gag(203-212) A*29 human epitope
                    ETINEEAAEW Gag(203-212) A*34 human epitope
                    ETINEEAAEW Gag(203-212) A*68:01 human epitope
                    ETINEEAAEW Gag(203-212) B*35:01, B*35:08 human epitope
                    ETINEEAAEW Gag(203-212) B53 human epitope
                    DTINEEAAEW Gag(203-212) B53 human epitope
                    DTINEEAAEW Gag(203-212) B53 human epitope
                    eTINEEAAEW Gag(203-212) diminished response; subtype-specific susceptible form
                    ETINEEAAEW Gag(203-212) B53, B58 human epitope
                    dTINEEAAEW Gag(203-212) observed variant
                    ETINEEAAEW Gag(203-212) B*53:01 human epitope
                    DTINEEAAEW Gag(203-212) B*53:01 human epitope
                    DTINEEAAEW Gag(203-212) B*58:01 human epitope
                    ETINEEAAEW Gag(203-212) C*16 human epitope
                    ETINEEAAEW Gag(203-212) human epitope
                    DTINEEAAEW Gag(203-212) human epitope
                    ETINEEAAEW Gag(203-212) human epitope
                    ETINEEAAEW Gag(203-212) human epitope
                    DTINEEAAEWDRIYK Gag(203-217) human epitope
                    ETINEEAAEWDRVHPVVHAGP Gag(203-222) human epitope
                     TINEEAAEW Gag(204-212) B57 human epitope
                     IINEEAADWDL Gag(204-214) Mamu-A1*043:01 macaque epitope
                     IINEEAADQDL Gag(204-214) Mamu A*90120-5 macaque epitope
                     TINEEAAEWDRLHPV Gag(204-218) human epitope
                     TINEEAAEWDRLHPV Gag(204-218) human epitope
                     TINEEAAEWDRLHPVHAG Gag(204-221) human epitope
                      INEEAAEWDRVHPVH Gag(205-219) A2 human epitope
                      INEEAAEWDRLHPVH Gag(205-219) human epitope
                      INEEAAEWDRLHPVH Gag(205-219) human epitope
                      INEEAAEWDRVHPVH Gag(205-219) human epitope
                      INEEAAEWDRlHPVH Gag(205-219) susceptible form
                      INEEAAEWDRLHPVH Gag(205-219) human epitope
                      INEEAAEWDRvHPVH Gag(205-219) susceptible form
                        EEAAEWDRV Gag(207-215) B*40 human epitope
                        EEAAEWDRl Gag(207-215) subtype-specific susceptible form
                        EEAAEWDRL Gag(207-215) B40 human epitope
                        EEAAEWDRL Gag(207-215) human epitope
                        EEAAEWDRIYKRWII Gag(207-218) human epitope
                         EAAEWDRLH Gag(208-216) human epitope
                         EAAEWDRLHPVHAGP Gag(208-222) human epitope
                          AAEWDRLHP Gag(209-217) human epitope
                          AAEWDRLHPV Gag(209-218) human epitope
                          AAEWDRmHPV Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                          AAEWDRaHPV Gag(209-218) HLA association
                          AAEWDRqHPV Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                          AAEWDRsHPV Gag(209-218) HLA association
                          AAEWDRtHPV Gag(209-218) HLA association
                          AAEWDRvHPV Gag(209-218) HLA association
                          AAEWDRiHPV Gag(209-218) HLA association
                          -AEWDRxHPV Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                          AAEWDRxHP- Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                          AAEWDRLHPVH Gag(209-219) human epitope
                          AAEWDRVHPVHAGPI Gag(209-223) A2, B40, B44 human epitope
                          AAEWDRLHPVHAGPI Gag(209-223) H-2d mouse epitope
                          AAEWDRLHPVHAGPI Gag(209-223) human epitope
                          AAEWDRLHPVHAGPI Gag(209-223) human epitope
                          AAEWDRVHPVHAGPI Gag(209-223) human epitope
                          AAEWDRlHPVHAGPI Gag(209-223) susceptible form
                          AAEWDRLHPVHAGPI Gag(209-223) mouse epitope
                          AAEWDRLHPVHAGPI Gag(209-223) human epitope
                          AAEWDRvHPVHAGPI Gag(209-223) susceptible form
                          AAEWDRLHPVHAGPIA Gag(209-224) human epitope
                          AAEWDRLHPVHAGPIA Gag(209-224) human epitope
                          AAEWDRLHPVHAGPIA Gag(209-224) human epitope
                           AEWDRVHP Gag(210-217) B*40:02 human epitope
                           AEWDRlHP Gag(210-217) subtype-specific susceptible form
                           AEWDRLHP Gag(210-217) B*40:02 human epitope
                           AEWDRvHP Gag(210-217) subtype-specific susceptible form
                           AEWDRLHPV Gag(210-218) A2 human epitope
                           AEWDRLHPV Gag(210-218) A2 human epitope
                           AEWgRLHPV Gag(210-218) observed variant
                           AdWDRvHPV Gag(210-218) observed variant
                           AE*DRLHPV Gag(210-218) observed variant
                           AEWDRLHPV Gag(210-218) A2 human epitope
                           AEWDRVHPV Gag(210-218) A*23 human epitope
                           AEWDRVHPV Gag(210-218) B*18 human epitope
                           AEWDRVHPV Gag(210-218) B*35:02, B*35:03, B*53:01 human epitope
                           AEWDRLHPV Gag(210-218) B*40 human epitope
                           AEWDRVHPV Gag(210-218) B*40 human epitope
                           AEWDRlHPV Gag(210-218) subtype-specific susceptible form
                           AEWDRVHPV Gag(210-218) B*40 human epitope
                           AEWDRVHPV Gag(210-218) B40 human epitope
                           AEWDRLHPV Gag(210-218) B40 human epitope
                           AEWDRVHPV Gag(210-218) B*40:02 human epitope
                           AEWDRVHPV Gag(210-218) B*40:02 human epitope
                           AEWDRLHPV Gag(210-218) B*40:02 human epitope
                           AEWDRvHPV Gag(210-218) subtype-specific susceptible form
                           AEWDRVHPV Gag(210-218) B*40:02 human epitope
                           AEWDRlHPV Gag(210-218) subtype-specific susceptible form
                           AEWDRLHPV Gag(210-218) B*40:02 human epitope
                           AEWDRLHPV Gag(210-218) B*40:06 human epitope
                           AEWDRVHPV Gag(210-218) human epitope
                           AEWDRVHPV Gag(210-218) human epitope
                           {A}tEWDRVHPV{HAGPIPPG} Gag(210-218) observed variant
                           {A}AdWDRVHPV{HAGPIPPG} Gag(210-218) observed variant
                           {A}AdWDRgHPV{HAGPIPPG} Gag(210-218) observed variant
                           {A}AdWDRgHPV{HAGPIPlG} Gag(210-218) observed variant
                           {A}vEWDRaHPi{HAGPIPPG} Gag(210-218) observed variant
                            EWDRVHPV Gag(211-218) A2 human epitope
                            EWDRLHPVHAG Gag(211-221) B*40:02 human epitope
                            EWDRvHPVHAG Gag(211-221) subtype-specific susceptible form
                            EWDRVHPVHAG Gag(211-221) B*40:02 human epitope
                            EWDRlHPVHAG Gag(211-221) subtype-specific susceptible form
                            EWDRLHPVHAGPIAPGQMRE Gag(211-230) human epitope
                             WDRLHPVHAGPIAPGQMR Gag(212-229) human epitope
                              DRVHPVHAGPI Gag(213-223) macaque epitope
                              DRVHPVHAGPIAPGQ Gag(213-227) B7 human epitope
                              DRLHPVHAGPIAPGQ Gag(213-227) human epitope
                              DRLHPVHAGPIAPGQ Gag(213-227) human epitope
                              DRvHPVHAGPIAPGQ Gag(213-227) susceptible form
                              DRLHPVHAGPAAPGQMREPR Gag(213-232) human epitope
                              DRLHPVHAGPiAPGQMREPR Gag(213-232) diminished response
                               RLHPVHAGP Gag(214-222) human epitope
                               RLHPVHAGPIA Gag(214-224) A*02 human epitope
                               RLHPVHAGPIA Gag(214-224) human epitope
                                LHPVHAGPI Gag(215-223) human epitope
                                VHPVHAGPIA Gag(215-224) B55 human epitope
                                VHPVHAGPIA Gag(215-224) B55 human epitope
                                lHPVHAGPvA Gag(215-224) susceptible form
                                lHPVHAGPIA Gag(215-224) susceptible form
                                lHPVHAGPIt Gag(215-224) susceptible form
                                lHPaqAGPIA Gag(215-224) susceptible form
                                 HPVHAGPI Gag(216-223) B35 human epitope
                                 HPVHAGPV Gag(216-223) B35 human epitope
                                 HPVHAGPI Gag(216-223) B35 human epitope
                                 HPVHAGPV Gag(216-223) human epitope
                                 HPVHAGPi Gag(216-223) susceptible form
                                 HPVHAGPI Gag(216-223) human epitope
                                 HPVHAGPv Gag(216-223) susceptible form
                                 HPVHAGPIA Gag(216-224) A*68:02 human epitope
                                 HPVHAGPIA Gag(216-224) B*07 human epitope
                                 HPVHAGPIA Gag(216-224) B*07 human epitope
                                 HPVHAGPvA Gag(216-224) observed variant
                                 HPVHAGPIA Gag(216-224) B*07:02 human epitope
                                 HPVHAGPIA Gag(216-224) B*07:02 human epitope
                                 HPVHAGPIA Gag(216-224) B35 human epitope
                                 HPVHAGPIA Gag(216-224) B35 human epitope
                                 HPVHAGPIA Gag(216-224) B35, B7 human epitope
                                 HPVHAGPIA Gag(216-224) B*35:01 human epitope
                                 HPVHAGPIA Gag(216-224) B*35:01 human epitope
                                 HPVHAGPIA Gag(216-224) B*35:01 human epitope
                                 HPVHAGPIA Gag(216-224) B*35:01 human epitope
                                 HPVHAGPIA Gag(216-224) B*35:01 human epitope
                                 HPVHAGPIA Gag(216-224) B*35:02, B*35:03, B*53:01 human epitope
                                 HPVHAGPIA Gag(216-224) B39, B7 human epitope
                                 HPVHAGPIA Gag(216-224) B*39:10 human epitope
                                 HPVHAGPIA Gag(216-224) B*55 human epitope
                                 HPVHAGPIA Gag(216-224) B7 human epitope
                                 HPVHAGPIA Gag(216-224) B7 human epitope
                                 HPVHAGPIA Gag(216-224) B7 human epitope
                                 HPVHAGPIA Gag(216-224) B7 human epitope
                                 HPVHAGPVA Gag(216-224) B7 human epitope
                                 HPVHAGPVA Gag(216-224) B7 human epitope
                                 HPVHAGPIA Gag(216-224) B7 human epitope
                                 HPVHAGPVA Gag(216-224) B7 human epitope
                                 HPVHAGPIA Gag(216-224) B7 human epitope
                                 HPVHAGPVA Gag(216-224) B7 human epitope
                                 HPVHAGPIA Gag(216-224) B7 human epitope
                                 HVPHAGPIA Gag(216-224) B7 supertype human, mouse epitope
                                 HPVHAGPVA Gag(216-224) B7 supertype human epitope
                                 HPVqAGPVA Gag(216-224) non-susceptible form; susceptible form
                                 HPVHAGPiA Gag(216-224) non-susceptible form; susceptible form
                                 HPVHAGPip Gag(216-224) non-susceptible form; susceptible form
                                 HPVHAGPVp Gag(216-224) non-susceptible form; susceptible form
                                 HPaHAGPVA Gag(216-224) non-susceptible form; susceptible form
                                 HPVaAGPVA Gag(216-224) non-susceptible form; susceptible form
                                 HPVHvGPVA Gag(216-224) non-susceptible form; susceptible form
                                 HPVHAaPVA Gag(216-224) non-susceptible form; susceptible form
                                 HPVHAGPIA Gag(216-224) C*12 human epitope
                                 HPVHAGPIA Gag(216-224) human epitope
                                 HPVHAGPIA Gag(216-224) human epitope
                                 HPVHAGPVA Gag(216-224) human epitope
                                 HPVHAGPIA Gag(216-224) human epitope
                                 HPVHAGPIAPGQMREPR Gag(216-232) A*02 human epitope
                                   VHAGPIPPG Gag(218-226) human epitope
                                    HAGPIAPGQMREPRG Gag(219-233) A*02 human epitope
                                    HAGPIAPGQMREPRG Gag(219-233) A2 human epitope
                                    qAGPIAPGQMRdPRG Gag(219-233) observed variant
                                    HAGPIAPGQMREPRG Gag(219-233) A2 human epitope
                                    HAGPIAPGQMREPRG Gag(219-233) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health