HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

SALSEGATPQDLNTMLNTVGGH Gag(173-194) B14 human epitope
     GATPQDLNTMLNTVGGH Gag(178-194) human epitope
     GATPQDLNTMLNTVGGH Gag(178-194) human epitope
      ATPQDLNTMLNTVGG Gag(179-193) human epitope
       TPQDLNTMLNTVGGH Gag(180-194) human epitope
       TPQDLNTMLNTVGGH Gag(180-194) human epitope
       TPQDLNMMLNIVGGH Gag(180-194) human epitope
       TPQDLNTMLNTVGGHQAA Gag(180-197) human epitope
        PQDLNTMLNTVGGHQ Gag(181-195) A2 human epitope
        PQDLNTMLNTVGGHQ Gag(181-195) human epitope
          DLNTMLNTVGGHQAAMQMLK Gag(183-202) human epitope
          DLNTMLNTVGGHQAAMQMLKETINEEAAEWDR Gag(183-214) human epitope
           LNTMLNTGVGHQAAM Gag(184-198) human epitope
            NTMLNTVGGHQAAM Gag(185-198) human epitope
            NTMLNTVGGHQAAMQMLK Gag(185-202) human epitope
             MMLNIVGGH Gag(186-194) human epitope
               LNIVGGHQA Gag(188-196) human epitope
                NTVGGHQAAMQMLKE Gag(189-203) A2 human epitope
                NTVGGHQAAMQMLKE Gag(189-203) human epitope
                 IVGGHQAAM Gag(190-198) B*07:02 human epitope
                  VGGHQAAMQMLKET Gag(191-204) human epitope
                  VGGHQAAMQMLKDTI Gag(191-205) H-2Dd mouse epitope
                  VGGHQAAMQMLKDTI Gag(191-205) human epitope
                  VGGHQAAMQMLKDTINEEAAEWDR Gag(191-214) human, macaque epitope
                  VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) macaque epitope
                  VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) human, macaque epitope
                  VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) mouse epitope
                  VGGHQAAMQMLKdTINEEAAEWDR Gag(191-214) subtype-specific susceptible form
                   GGHQAAMQMLK Gag(192-202) human epitope
                   GGHQAAMQMLKDTIN Gag(192-206) human epitope
                   GGHQAAMQMLKDTINEEEA Gag(192-210) human epitope
                    GHQAAMQML Gag(193-201) B*07 human epitope
                    GHQAAMQML Gag(193-201) B*15 human epitope
                    GHQAAMQML Gag(193-201) B15, B39 human epitope
                    GHQAAMQML Gag(193-201) B*15:10 human epitope
                    GHQAAMQML Gag(193-201) B*15:10 human epitope
                    GHQAAMQML Gag(193-201) B*15:10 human epitope
                    GHQAAMQML Gag(193-201) B*15:10 human epitope
                    GHQAAMQML Gag(193-201) B*35:02, B*35:03, B*53:01 human epitope
                    GHQAAMQML Gag(193-201) B*38 human epitope
                    GHQAAMQML Gag(193-201) B38 human epitope
                    GHQAAMQML Gag(193-201) B*39 human epitope
                    GHQAAMQML Gag(193-201) B39 human epitope
                    GHQAAMQML Gag(193-201) B39 human epitope
                    GHQAAMQML Gag(193-201) B*39:01 human epitope
                    GHQAAMQML Gag(193-201) B*42:01 human epitope
                    GHQAAMQML Gag(193-201) B*52 human epitope
                    GHQAAMQML Gag(193-201) B*55 human epitope
                    GHQAAMQML Gag(193-201) C*14 human epitope
                    GHQAAMQML Gag(193-201) human epitope
                    GHQAAMQML Gag(193-201) human epitope
                    GHQAAMQMLKE Gag(193-203) A*02 human epitope
                    GHQAAMQMLKE Gag(193-203) A*02 human epitope
                    GHQAAMQMLKE Gag(193-203) A*02 human epitope
                    GHQAAMQMLKE Gag(193-203) A*02 human epitope
                    GHQAAMQMLKD Gag(193-203) A2 human epitope
                    GHQAAMQMLKE Gag(193-203) A2 human epitope
                    GHQAAMEMLKD Gag(193-203) A2 human epitope
                    GHQAAMQMLKETINE Gag(193-207) A2, B15 human epitope
                    GHQAAMQMLKETINE Gag(193-207) H-2d transgenic mouse epitope
                    GHQAAMQMLKETINE Gag(193-207) mouse epitope
                    GHQAAMQMLKETINE Gag(193-207) human epitope
                    GHQAAMQMLKETINEEAA Gag(193-210) human epitope
                    GHQAAMQMLKdTINEEAA Gag(193-210) subtype-specific susceptible form
                    GHQAAMQMKETINEEAAEW Gag(193-212) human epitope
                    GHQAAMQMLKETINEEAAEW Gag(193-212) human epitope
                    GHQAAMQMLKETINEEAAEWDR Gag(193-214) B52 human epitope
                     HQAAMQMLK Gag(194-202) A11 human epitope
                     HQAAMQMLK Gag(194-202) B52 human epitope
                     HQAAMQMLK Gag(194-202) B52 human epitope
                     HQAAMQMLK Gag(194-202) human epitope
                     HQAAMQMLKETINE Gag(194-207) human epitope
                       AAMQMLKDTINEEAA Gag(196-210) human epitope
                       AAMQMLKDTINEEAA Gag(196-210) human epitope
                       AAMQMLKETINEEAAEW Gag(196-212) human epitope
                        AMQMLKET Gag(197-204) H-2d mouse epitope
                        AMQMLKET Gag(197-204) H-2d mouse epitope
                        AMQMLKETI Gag(197-205) A2 human epitope
                        AMQMLKETI Gag(197-205) H-2Dd mouse epitope
                        AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
                        AMefLKDTa Gag(197-205) diminished HLA binding or increased off-rate
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKeTI Gag(197-205) diminished response
                        AMQiLKDTI Gag(197-205) diminished response
                        AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKDTI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2Kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2d mouse epitope
                        AMQMLKETI Gag(197-205) H-2d mouse epitope
                        AMQMLKETI Gag(197-205) H-2d human, mouse epitope
                        ANQMLKDTI Gag(197-205) H-2d mouse epitope
                        ANQMLKeTI Gag(197-205) subtype-specific susceptible form
                        AMQMLKETI Gag(197-205) H-2d mouse epitope
                        AMQMLKDTI Gag(197-205) H-2d mouse epitope
                        AMQMLKETI Gag(197-205) H-2d mouse epitope
                        AMQMLKETI Gag(197-205) H-2kd mouse epitope
                        AMQMLKETI Gag(197-205) H-2kd mouse epitope
                        AMQMLKETI? Gag(197-205) mouse epitope
                        AMQMLKDTI Gag(197-205) mouse epitope
                        AMQMLKDTI Gag(197-205) mouse epitope
                        AMQMLKDTI Gag(197-205) human epitope
                        AMQMLKDTI Gag(197-205) human epitope
                        AMQILKDTI Gag(197-205) mouse epitope
                        AMQMLKETI Gag(197-205) mouse epitope
                        AMQMLKETI Gag(197-205) epitope
                        AMQMLKDTI Gag(197-205) human, mouse epitope
                        AMQMLKeTI Gag(197-205)
                        AMQMLKETI Gag(197-205) human epitope
                        AMQMLKETI Gag(197-205) human, mouse epitope
                        AMQMLKdTI Gag(197-205) diminished response
                        AMQMLKETI Gag(197-205) mouse epitope
                        AMQMLKETINEEAAE Gag(197-211) B40 human epitope
                        AMQMLKETINEEAAE Gag(197-211) H-2d transgenic mouse epitope
                        AMQMLKETINEEAAE Gag(197-211) mouse epitope
                         MQMLKETI Gag(198-205) B*52:01 human epitope
                         MQMLKETI Gag(198-205) B*52:01 human epitope
                         MQMLKdTI Gag(198-205) non-susceptible form; observed variant
                         MQiLKETI Gag(198-205) observed variant; susceptible form
                         MQMLKDTI Gag(198-205) B*52:01 human, mouse epitope
                         MQMLKeTI Gag(198-205)
                         MQMLKETI Gag(198-205) B*52:01 human epitope
                         MQMLKETI Gag(198-205) B*52:01 human epitope
                         MQMLKETI Gag(198-205) B*52:01 human, mouse epitope
                         MQMLKdTI Gag(198-205)
                         MQMLKDTINEEAAE Gag(198-211) human epitope
                         MQMLKeTINEEAAE Gag(198-211) subtype-specific susceptible form
                         KQMLKDTINEEAAEWD Gag(198-213) human epitope
                         KQMLKDTINEEAEEWD Gag(198-213) human epitope
                          QMLKETINEEA Gag(199-209) B*52:01 human epitope
                          QMLKDTINEEA Gag(199-209) B*52:01 human, mouse epitope
                          QMLKeTINEEA Gag(199-209)
                          QMLKETINEEA Gag(199-209) B*52:01 human, mouse epitope
                          QMLKdTINEEA Gag(199-209)
                           MLKDTINEEAAEWDR Gag(200-214) human epitope
                           MLKDTINEEAAEWDR Gag(200-214) human epitope
                           MLKDTINEEAAEWDR Gag(200-214) human epitope
                            LKETINEEAAEWDR Gag(201-214) human epitope
                            LKETINEEAAEWDRV Gag(201-215) A25 human epitope
                            LKETINEEAAEWDRL Gag(201-215) H-2d transgenic mouse epitope
                            LKDTINEEAAEWDRLHPV Gag(201-218) A*68:01 human epitope
                            LKETINEEAAEWDRLHPV Gag(201-218) human epitope
                            LKdTINEEAAEWDRLHPV Gag(201-218) subtype-specific susceptible form
                            LKETINEEAAEWDRVPV Gag(201-218) human epitope
                            LKETINEEAAEWDRLHPV Gag(201-218) human epitope
                             KETINEEAA Gag(202-210) A*24 human epitope
                             KETINEEAA Gag(202-210) B*08 human epitope
                             KETINEEAA Gag(202-210) B*35:02, B*35:03, B*53:01 human epitope
                             KETINEEAA Gag(202-210) B*40 human, mouse epitope
                             KdTINEEAA Gag(202-210) observed variant; susceptible form
                             KDTINEEAA Gag(202-210) B*40 human, mouse epitope
                             KeTINEEAA Gag(202-210) observed variant; susceptible form
                             KETINEEAA Gag(202-210) B*40 human epitope
                             KETINEEAA Gag(202-210) B*40 human epitope
                             KETINEEAA Gag(202-210) B40 human epitope
                             KETINEEAA Gag(202-210) B*40:02 human epitope
                             KETINEEAA Gag(202-210) B*40:02 human epitope
                             KETINEEAA Gag(202-210) human epitope
                             KETINEEAA Gag(202-210) human epitope
                             KDTINEEAAEWDRL Gag(202-215) human epitope
                              ETINEEAAEW Gag(203-212) A*25 human epitope
                              ETINEEAAEW Gag(203-212) A*25 human epitope
                              ETINEEAAEW Gag(203-212) A*25 human epitope
                              ETINEEAAEW Gag(203-212) A*25 human epitope
                              ETINdEAAEW{DRl} Gag(203-212) diminished response; escape documented in this paper; observed variant; processing
                              ETINdEAAEW{DRV} Gag(203-212) observed variant; replicative capacity reduced; susceptible form
                              ETINEEAAEW{DRl} Gag(203-212) observed variant; replicative capacity is not abrogated; susceptible form
                              EIINEEAAEW Gag(203-212) A*25 human epitope
                              ETINEEAAEW Gag(203-212) A*25 human epitope
                              ETINEEAAEW Gag(203-212) A*25 human epitope
                              ETINEEAAEW Gag(203-212) A25 human epitope
                              ETINEEAAEW Gag(203-212) A25 human epitope
                              ETINdEAAEW Gag(203-212) susceptible form
                              ETINEEAAEW Gag(203-212) A25 human epitope
                              ETINEEAAEW Gag(203-212) A25 human epitope
                              ETINEEAAEW Gag(203-212) A25, B53 human epitope
                              ETINEEAAEW Gag(203-212) A*25:01 human epitope
                              ETINEEAAEW Gag(203-212) A*25:01 human epitope
                              ETINdEAAEW Gag(203-212) diminished response
                              ETINEEAAEW Gag(203-212) A*25:01 human epitope
                              ETINEEAAEW Gag(203-212) A*25:01 human epitope
                              dTINEEAAEW Gag(203-212) observed variant
                              ETINEEAAEW Gag(203-212) A*25:01 human epitope
                              ETINdEAAEW Gag(203-212) diminished response
                              ETINEEAAEW Gag(203-212) A*25:01 human epitope
                              ETINEEAAAEW Gag(203-212) A*25:01 human epitope
                              ETINEEAAEW Gag(203-212) A*25:01 human epitope
                              ETINEEAAEW Gag(203-212) A*29 human epitope
                              ETINEEAAEW Gag(203-212) A*34 human epitope
                              ETINEEAAEW Gag(203-212) A*68:01 human epitope
                              ETINEEAAEW Gag(203-212) B*35:01, B*35:08 human epitope
                              ETINEEAAEW Gag(203-212) B53 human epitope
                              DTINEEAAEW Gag(203-212) B53 human epitope
                              eTINEEAAEW Gag(203-212) diminished response; subtype-specific susceptible form
                              DTINEEAAEW Gag(203-212) B53 human epitope
                              ETINEEAAEW Gag(203-212) B53, B58 human epitope
                              dTINEEAAEW Gag(203-212) observed variant
                              DTINEEAAEW Gag(203-212) B*53:01 human epitope
                              ETINEEAAEW Gag(203-212) B*53:01 human epitope
                              DTINEEAAEW Gag(203-212) B*58:01 human epitope
                              ETINEEAAEW Gag(203-212) C*16 human epitope
                              ETINEEAAEW Gag(203-212) human epitope
                              ETINEEAAEW Gag(203-212) human epitope
                              ETINEEAAEW Gag(203-212) human epitope
                              DTINEEAAEW Gag(203-212) human epitope
                              DTINEEAAEWDRIYK Gag(203-217) human epitope
                              ETINEEAAEWDRVHPVVHAGP Gag(203-222) human epitope
                               TINEEAAEW Gag(204-212) B57 human epitope
                               IINEEAADWDL Gag(204-214) Mamu-A1*043:01 macaque epitope
                               IINEEAADQDL Gag(204-214) Mamu A*90120-5 macaque epitope
                               TINEEAAEWDRLHPV Gag(204-218) human epitope
                               TINEEAAEWDRLHPV Gag(204-218) human epitope
                               TINEEAAEWDRLHPVHAG Gag(204-221) human epitope
                                INEEAAEWDRVHPVH Gag(205-219) A2 human epitope
                                INEEAAEWDRLHPVH Gag(205-219) human epitope
                                INEEAAEWDRLHPVH Gag(205-219) human epitope
                                INEEAAEWDRVHPVH Gag(205-219) human epitope
                                INEEAAEWDRlHPVH Gag(205-219) susceptible form
                                INEEAAEWDRLHPVH Gag(205-219) human epitope
                                INEEAAEWDRvHPVH Gag(205-219) susceptible form
                                  EEAAEWDRV Gag(207-215) B*40 human epitope
                                  EEAAEWDRl Gag(207-215) subtype-specific susceptible form
                                  EEAAEWDRL Gag(207-215) B40 human epitope
                                  EEAAEWDRL Gag(207-215) human epitope
                                  EEAAEWDRIYKRWII Gag(207-218) human epitope
                                   EAAEWDRLH Gag(208-216) human epitope
                                   EAAEWDRLHPVHAGP Gag(208-222) human epitope
                                    AAEWDRLHP Gag(209-217) human epitope
                                    AAEWDRLHPV Gag(209-218) human epitope
                                    AAEWDRmHPV Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                                    AAEWDRaHPV Gag(209-218) HLA association
                                    AAEWDRqHPV Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                                    AAEWDRsHPV Gag(209-218) HLA association
                                    AAEWDRtHPV Gag(209-218) HLA association
                                    AAEWDRvHPV Gag(209-218) HLA association
                                    AAEWDRiHPV Gag(209-218) HLA association
                                    -AEWDRxHPV Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                                    AAEWDRxHP- Gag(209-218) HLA association; diminished HLA binding or increased off-rate
                                    AAEWDRLHPVH Gag(209-219) human epitope
                                    AAEWDRVHPVHAGPI Gag(209-223) A2, B40, B44 human epitope
                                    AAEWDRLHPVHAGPI Gag(209-223) H-2d mouse epitope
                                    AAEWDRLHPVHAGPI Gag(209-223) human epitope
                                    AAEWDRLHPVHAGPI Gag(209-223) mouse epitope
                                    AAEWDRLHPVHAGPI Gag(209-223) human epitope
                                    AAEWDRVHPVHAGPI Gag(209-223) human epitope
                                    AAEWDRlHPVHAGPI Gag(209-223) susceptible form
                                    AAEWDRLHPVHAGPI Gag(209-223) human epitope
                                    AAEWDRvHPVHAGPI Gag(209-223) susceptible form
                                    AAEWDRLHPVHAGPIA Gag(209-224) human epitope
                                    AAEWDRLHPVHAGPIA Gag(209-224) human epitope
                                    AAEWDRLHPVHAGPIA Gag(209-224) human epitope
                                     AEWDRLHP Gag(210-217) B*40:02 human epitope
                                     AEWDRvHP Gag(210-217) subtype-specific susceptible form
                                     AEWDRVHP Gag(210-217) B*40:02 human epitope
                                     AEWDRlHP Gag(210-217) subtype-specific susceptible form
                                     AEWDRLHPV Gag(210-218) A2 human epitope
                                     AEWDRLHPV Gag(210-218) A2 human epitope
                                     AEWgRLHPV Gag(210-218) observed variant
                                     AdWDRvHPV Gag(210-218) observed variant
                                     AE*DRLHPV Gag(210-218) observed variant
                                     AEWDRLHPV Gag(210-218) A2 human epitope
                                     AEWDRVHPV Gag(210-218) A*23 human epitope
                                     AEWDRVHPV Gag(210-218) B*18 human epitope
                                     AEWDRVHPV Gag(210-218) B*35:02, B*35:03, B*53:01 human epitope
                                     AEWDRVHPV Gag(210-218) B*40 human epitope
                                     AEWDRlHPV Gag(210-218) subtype-specific susceptible form
                                     AEWDRLHPV Gag(210-218) B*40 human epitope
                                     AEWDRVHPV Gag(210-218) B*40 human epitope
                                     AEWDRLHPV Gag(210-218) B40 human epitope
                                     AEWDRVHPV Gag(210-218) B40 human epitope
                                     AEWDRVHPV Gag(210-218) B*40:02 human epitope
                                     AEWDRLHPV Gag(210-218) B*40:02 human epitope
                                     AEWDRvHPV Gag(210-218) subtype-specific susceptible form
                                     AEWDRVHPV Gag(210-218) B*40:02 human epitope
                                     AEWDRlHPV Gag(210-218) subtype-specific susceptible form
                                     AEWDRVHPV Gag(210-218) B*40:02 human epitope
                                     AEWDRLHPV Gag(210-218) B*40:02 human epitope
                                     AEWDRLHPV Gag(210-218) B*40:06 human epitope
                                     AEWDRVHPV Gag(210-218) human epitope
                                     AEWDRVHPV Gag(210-218) human epitope
                                     {A}tEWDRVHPV{HAGPIPPG} Gag(210-218) observed variant
                                     {A}AdWDRVHPV{HAGPIPPG} Gag(210-218) observed variant
                                     {A}AdWDRgHPV{HAGPIPPG} Gag(210-218) observed variant
                                     {A}AdWDRgHPV{HAGPIPlG} Gag(210-218) observed variant
                                     {A}vEWDRaHPi{HAGPIPPG} Gag(210-218) observed variant
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health