HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

VIPMFSALSEGATPQDLN Gag(168-185) human, macaque epitope
VIPMFSALSEGATPQDLN Gag(168-185) mouse epitope
VIPMFtALSEGATPQDLN Gag(168-185) subtype-specific susceptible form
VIPMFSALSEGATPQDLN Gag(168-185) macaque epitope
VIPMFTALSEGATPQDLN Gag(168-185) human, macaque epitope
 IPMFSALSEGATPQD Gag(169-183) A2, B44 human epitope
 IPMFSALSEGATPQDL Gag(169-184) B12 human epitope
 IPMFSALSEGATPDQL Gag(169-184) B44 human epitope
 IPMFSALSEGATPQDL Gag(169-184) B44 human epitope
  PMFTALSEGATPQDLNTM Gag(170-187) C*08 human epitope
  PMFSALSEGATPQDLNTM Gag(170-187) human epitope
  PMFtALSEGATPQDLNTM Gag(170-187) subtype-specific susceptible form
  PMFSALSEGATPQDLNTM Gag(170-187) human epitope
  PMFSALSEGATPQDLNTM Gag(170-187) human epitope
   MFSALSEGATPHDLN Gag(171-185) human epitope
   MFTALSEGTPQDLNTMLNT Gag(171-190) human epitope
    FSALSEGATPQDLNT Gag(172-186) human epitope
     SALSEGATPQDLNTM Gag(173-187) B44 human epitope
     SALSEGATPQDLNTM Gag(173-187) human epitope
     SALSEGATPQDLNTML Gag(173-188) human epitope
     QALSEGCTPYDINQML Gag(173-188) human epitope
     SALSEGATPQDLNMMLNIVG Gag(173-192) B*81:01 human epitope
     SALSEGATPQDLNtMLNtVG Gag(173-192) observed variant
     SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
     SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
     SALSEGATPQDLNmMLNiVG Gag(173-192) observed variant
     tALSEGATPQDLNTMLNTVG Gag(173-192) inferred escape
     SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
     SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
     SALSEGATPQDLNTMLNTVGGH Gag(173-194) B14 human epitope
      ALSEGATPQDL Gag(174-184) human epitope
      ALSEGATPQDLNMM Gag(174-187) human epitope
       LSEGATPQD Gag(175-183) human epitope
       LSEGATPQDL Gag(175-184) B42, B44 human epitope
       LSEGATPQDL Gag(175-184) B*44:03 human epitope
       LSEGATPQDLNTMLN Gag(175-189) human epitope
        SEGATPQDL Gag(176-184) B*35:02, B*35:03, B*53:01 human epitope
        SEGATPQDL Gag(176-184) B*40 human epitope
        SEGATPQDL Gag(176-184) B40 human epitope
        SEGATPQDL Gag(176-184) B40 human epitope
        SEGATPQDL Gag(176-184) B40 human epitope
        SEGATPQDL Gag(176-184) B*40:01 human epitope
        SEGATPQDL Gag(176-184) B*40:01 human epitope
        SEGATPQDL Gag(176-184) B*44 human epitope
        SEGATPQDL Gag(176-184) B*44 human epitope
        SEGATPQDL Gag(176-184) B44 human epitope
        SEGATPQDL Gag(176-184) B*55 human epitope
        SEGATPQDL Gag(176-184) B*60, B*61 human epitope
        SEGATPQDL Gag(176-184) B60 human epitope
        SEGATPQDL Gag(176-184) B60 human epitope
        SEGATPQDL Gag(176-184) B60 human epitope
        SEGATPQDL Gag(176-184) B60 human epitope
        SEGATPQDL Gag(176-184) B60 human epitope
        SEGATPQDL Gag(176-184) human epitope
        SEGATPQDLNTMLNT Gag(176-190) human epitope
         EGATPQDLNMM Gag(177-187) B*67:01 human, mouse epitope
         EGATPQDLNtM Gag(177-187)
         EGATPQDLNTM Gag(177-187) B*67:01 human, mouse epitope
         EGATPQDLNmM Gag(177-187)
         EGATPQDLNMML Gag(177-188) human epitope
         EGATPQDLNTMLNTV Gag(177-191) B*57 human epitope
         EGATPQDLNTMLNTV Gag(177-191) B7 human epitope
         EGATPQDLNTMLNTV Gag(177-191) human epitope
         EGATPQDLNTMLNTVG Gag(177-192) human epitope
          GATPQDLNM Gag(178-186) human epitope
          GATPQDLNMMLNIV Gag(178-191) human epitope
          GATPQDLNTMLNTV Gag(178-191) human epitope
          GATPQDLNTMLNTVGGH Gag(178-194) human epitope
          GATPQDLNTMLNTVGGH Gag(178-194) human epitope
           ATPQDLNTM Gag(179-187) B7 human epitope
           CTPYDINQM Gag(179-187) Mamu A*01 macaque epitope
           CTPYDINQM Gag(179-187) Mamu A*01 macaque epitope
           ATPQDLNTML Gag(179-188) B*07, B*58 human epitope
           ATPQDLNMML Gag(179-188) B53 human epitope
           CTPYDINQML Gag(179-188) macaque epitope
           ATPQDLNTMLNT Gag(179-190) B58 human epitope
           CTPYDINQMLNC Gag(179-190) B58 human epitope
           ATPQDLNTMLNT Gag(179-190) B*58:02 human epitope
           ATPQDLNTMLNTVGG Gag(179-193) human epitope
            TPQDLNTM Gag(180-187) B*07 human, transgenic mouse epitope
            TPQDLNTM Gag(180-187) B*07 human epitope
            TPQDLNTM Gag(180-187) B*81:01 human epitope
            TPQDLNTML Gag(180-188) A*29 human epitope
            TPQDLNTML Gag(180-188) B*07 human, transgenic mouse epitope
            TPQDLNTML Gag(180-188) B*07 human epitope
            TPQDLNTML Gag(180-188) B*07 human epitope
            TPQDLNTML Gag(180-188) B*07, B*53:01, B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*07:02 human epitope
            TPQDLNTML Gag(180-188) B*07:02 human epitope
            TPQDLNMML Gag(180-188) B*07:02 human epitope
            TPQDLNTML Gag(180-188) B*07:02 human epitope
            TPQDLNTML Gag(180-188) B*07:02, B*39:10, B*42:01, B*81:01, C*08:02 human epitope
            TPtDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
            TPeDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
            TPgDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
            TPsDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
            TPQDLNsML Gag(180-188) escape documented in this paper; replicative capacity reduced
            TPQDLNTML Gag(180-188) B*07:02, B*42:01, B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*07:02, B*42:01, B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*14 human epitope
            TPQDLNTML Gag(180-188) B*35, B*53 human epitope
            TPhDLNTML Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) B*35:02, B*35:03, B*53:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01, B*81:01, B39, C*08:02 human epitope
            TPQDLNTML Gag(180-188) B39, B7 human epitope
            TPQDLNTML Gag(180-188) B*39:10 human epitope
            TPQDLNTML Gag(180-188) B*39:10 human epitope
            TPQDLNTML Gag(180-188) B*39:10 human epitope
            TPQDLNTML Gag(180-188) B*39:10, B*81:01 human epitope
            TPtDLNTML{...h...t} Gag(180-188) observed variant
            TPsDLNTML{...h...t} Gag(180-188) observed variant
            TPQDLNTML{...a} Gag(180-188) observed variant
            TPsDLNTML{...a...v} Gag(180-188) observed variant
            {d...}aPsDLNsML{...a} Gag(180-188) observed variant
            {d...}TPsDLNsML{...v} Gag(180-188) observed variant
            {d...}TPsDLNsML{...q...v} Gag(180-188) observed variant
            TPaDLNTML{...v...v} Gag(180-188) observed variant
            TPgDLNTML{...v...v} Gag(180-188) observed variant
            TPhDLNTML{...i} Gag(180-188) observed variant
            TPtDLNTML{...i} Gag(180-188) observed variant
            TPaDLNTML{...i} Gag(180-188) observed variant
            TPsDLNTML{...i} Gag(180-188) observed variant
            TPsDLNsML Gag(180-188) observed variant
            TPsDLNsML{...t} Gag(180-188) observed variant
            TPtDLNTML{...v} Gag(180-188) observed variant
            TPQDLNTMf{...q...v...i} Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) B*40 human epitope
            TPQDLNTML Gag(180-188) B*42 human epitope
            TPQDLNTML Gag(180-188) B*42 human epitope
            TPQDLNTML Gag(180-188) B*42 human epitope
            TPQDLNTML Gag(180-188) B*42, B*81 human epitope
            TPQDLNMML Gag(180-188) B*42, B*81 human epitope
            TPQDLNTML Gag(180-188) B*42, B*81 human epitope
            TPQDLNTML Gag(180-188) B*42, C*08 human epitope
            TPQDLNTML Gag(180-188) B42 human epitope
            TPQDLNTML Gag(180-188) B42 human epitope
            TPQDLNTML Gag(180-188) B42 human epitope
            TPQDLNTML Gag(180-188) B42, B53, B7, B81 human epitope
            TPQDLNTML Gag(180-188) B42, B7 human epitope
            TPQDLNTML Gag(180-188) B42, B7, B81 human epitope
            TPQDLNmML Gag(180-188) diminished response
            TPQDLNTML Gag(180-188) B42, B7, Cw8 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPtDLNTML Gag(180-188) escape documented in this paper; observed variant
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPTDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTNL Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPxDLNTML Gag(180-188) escape documented in this paper
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPtDLNTML Gag(180-188) literature escape
            TPaDLNTML Gag(180-188) observed variant
            TPsDLNTML Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01, B*42:02, B*81:01 human epitope
            TPQDLNMML Gag(180-188) B*42:01, B*81:01 human epitope
            iPQDLNMML Gag(180-188) HLA association; observed variant
            iPhDLNMML Gag(180-188) HLA association; observed variant
            TPsDLNMML Gag(180-188) HLA association; observed variant
            TPhDLNMML Gag(180-188) HLA association; observed variant
            TPQDLNvML Gag(180-188) HLA association; observed variant
            TPgDLNMML Gag(180-188) HLA association; observed variant
            TPQDLNtML Gag(180-188) HLA association; observed variant
            TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
            TPQDLNsML Gag(180-188) HLA association; observed variant
            TPsDLNsML Gag(180-188) HLA association; observed variant
            TPaDLNTML Gag(180-188) HLA association; observed variant
            TPtDLNTML Gag(180-188) HLA association; observed variant
            TPgDLNTML Gag(180-188) HLA association; observed variant
            TPQDLNMML Gag(180-188) B*42:02 human epitope
            TPQDLNtML Gag(180-188) subtype-specific non-susceptible form; subtype-specific susceptible form
            TPQDLNMML Gag(180-188) B*53 human epitope
            TPYDINQML Gag(180-188) B*53 human epitope
            TPYDINQML Gag(180-188) B53 human epitope
            TPQDLNQML Gag(180-188) B53 human epitope
            TPYDINQML Gag(180-188) B53 human epitope
            TPQDLNTML Gag(180-188) B53 human epitope
            TPQDLNMML Gag(180-188) B53 human epitope
            TPQDLNMML Gag(180-188) B53 human epitope
            TPQDLNtML Gag(180-188) subtype-specific non-susceptible form; TCR related mutation
            TPQDLNMML Gag(180-188) B53 human epitope
            TPYDINQML Gag(180-188) B53 human epitope
            TPQDLNMML Gag(180-188) B53 human epitope
            TPQDLNMML Gag(180-188) B*53:01 human epitope
            TPYDINQML Gag(180-188) B*53:01 human epitope
            TPYDINQML Gag(180-188) B*53:01 human epitope
            TPYDINQML Gag(180-188) B*58:01 human epitope
            TPQDLNTML Gag(180-188) B*67:01 human epitope
            TPsDLNlML Gag(180-188) non-susceptible form; observed variant
            TPaDLNlML Gag(180-188) non-susceptible form; observed variant
            TPQDLNTML Gag(180-188) B*67:01 human, mouse epitope
            TPQDLNmML Gag(180-188)
            TPQDLNTML Gag(180-188) B*67:01 human epitope
            TPQDLNTML Gag(180-188) B*67:01 human epitope
            TPQDLNMML Gag(180-188) B*67:01 human, mouse epitope
            TPQDLNtML Gag(180-188)
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B7 human epitope
            TPQDLNTML Gag(180-188) B*81 human epitope
            TPQDmNTML Gag(180-188) calculated escape
            TPQDsNTML Gag(180-188) calculated escape
            TPQDyNTML Gag(180-188) calculated escape
            TPQDLNTML Gag(180-188) B*81 human epitope
            TPQDLNTML Gag(180-188) B*81 human epitope
            TPQDLNTML Gag(180-188) B*81 human epitope
            TPQDLNTML Gag(180-188) B*81 human epitope
            TPQDLNTML? Gag(180-188) B81 human epitope
            TPQDLNTML Gag(180-188) B81 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNmML Gag(180-188) literature escape
            TPgDLNTML Gag(180-188) observed variant
            TPQDLNsML Gag(180-188) observed variant
            TPsDLNTML Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPeDLNTML Gag(180-188) observed variant
            TPsDLNsML Gag(180-188) observed variant
            TPQDLNmML Gag(180-188) observed variant
            TPsDLNTMf Gag(180-188) observed variant
            TPQDLNaML Gag(180-188) observed variant
            TPrDLNmML Gag(180-188) observed variant
            TPaDLNTML Gag(180-188) observed variant
            TPrDLNTML Gag(180-188) observed variant
            TPgDLNTML Gag(180-188) observed variant
            TPQDLNTfL Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) B*81:01 human epitope
            TPQDLNTML Gag(180-188) C*08 human epitope
            TPQDLNTML Gag(180-188) C*08 human epitope
            TPQDLNTML Gag(180-188) C*08 human epitope
            TPQDLNTML Gag(180-188) C*08 human epitope
            TPQDLNTML Gag(180-188) C*08:02 human epitope
            TPQDLNTML Gag(180-188) C*08:02 human epitope
            TPQDLNTML Gag(180-188) C*08:02 human epitope
            TPQDLNTML Gag(180-188) C*12 human epitope
            TPQDLNTML Gag(180-188) C*14 human epitope
            TPQDLNTML Gag(180-188) C*17 human epitope
            TPQDLNTML Gag(180-188) Cw8 human epitope
            TPQDLNTML Gag(180-188) Cw8 human epitope
            TPQDLNTML Gag(180-188) human epitope
            TPYDINQML Gag(180-188) human epitope
            TPqDlNtML Gag(180-188) observed variant
            TPqDlNmML Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) human epitope
            TPYDINQML Gag(180-188) human epitope
            TPQDLNTML Gag(180-188) human epitope
            TPQDLNTML Gag(180-188) human epitope
            TPyDiNqML Gag(180-188) observed variant
            TPQDLNmML Gag(180-188) observed variant
            TPYDINQML Gag(180-188) human epitope
            TPQDLNMML Gag(180-188) human epitope
            TPQDLNtML Gag(180-188) observed variant
            TPyDiNqML Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) human epitope
            TPQDLNTML Gag(180-188) human epitope
            TPQDLNsML Gag(180-188) escape documented in this paper
            TPtDLNTML Gag(180-188) escape documented in this paper
            TPsDLNTML Gag(180-188) escape documented in this paper
            TPpDLNTML Gag(180-188) observed variant
            TPaDLNTML Gag(180-188) escape documented in this paper
            TPvDLNTML Gag(180-188) observed variant
            TPhDLNTML Gag(180-188) observed variant
            TPQDLNmML Gag(180-188) escape documented in this paper
            TsQDLNTML Gag(180-188) observed variant
            TPeDLNTML Gag(180-188) observed variant
            TPsDLNsML Gag(180-188) observed variant
            TPgDLNTML Gag(180-188) observed variant
            aPQDLNTMv Gag(180-188) observed variant
            nPQDLNTML Gag(180-188) observed variant
            TPsDLNTMf Gag(180-188) observed variant
            TPQDLyTML Gag(180-188) observed variant
            TPQDLNTfL Gag(180-188) observed variant
            TPQDLNTvL Gag(180-188) observed variant
            TqQDLNpML Gag(180-188) observed variant
            aPQDLNTML Gag(180-188) observed variant
            TPQDLNTML Gag(180-188) human epitope
            TPQDLNTMLN Gag(180-189) B14, B7 human epitope
            TPQDLNTMLN Gag(180-189) B7 human epitope
            TPQDLNMMLN Gag(180-189) B7 human epitope
            TPQDLNMMLN Gag(180-189) B7 human epitope
            TPQDLNTMLNT Gag(180-190) B14 human epitope
            TPQDLNQMLNTV Gag(180-191) B58 human epitope
            TPQDLNtMLNTV Gag(180-191) observed variant
            TPQDLNTMLNTVGGH Gag(180-194) human epitope
            TPQDLNTMLNTVGGH Gag(180-194) human epitope
            TPQDLNMMLNIVGGH Gag(180-194) human epitope
            TPQDLNTMLNTVGGHQAA Gag(180-197) human epitope
             PQDLNTMLN Gag(181-189) B14, Cw8 human epitope
             PQDLNTMLN Gag(181-189) Cw7 human epitope
             PQDLNTMLNTV Gag(181-191) B14 human epitope
             PQDLNTMLNTVGGHQ Gag(181-195) A2 human epitope
             PQDLNTMLNTVGGHQ Gag(181-195) human epitope
               DLNTMLNTV Gag(183-191) B*14 human epitope
               DLNMMLNIV Gag(183-191) B14 human epitope
               DLNMMLNIV Gag(183-191) B14 human epitope
               DLNMtLNvV Gag(183-191) susceptible form
               DLNMMLNIV Gag(183-191) B14 human epitope
               DLNMMLNIV Gag(183-191) B14 human epitope
               DLNTMLNTV Gag(183-191) B14, Cw8 human epitope
               DLNmMLNiV Gag(183-191) observed variant
               DLNTMLNTV Gag(183-191) B14, Cw8 human epitope
               DLNTMLNTV Gag(183-191) B*14:02, Cw8 human epitope
               DLNnMLNiV Gag(183-191) susceptible form
               DLNTMLNTV Gag(183-191) Cw8 human epitope
               DLNTMLNTV Gag(183-191) chimpanzee epitope
               DLNTMLNTVG Gag(183-192) A2, B14 human epitope
               DLNTMLNTVGGHQAAMQMLK Gag(183-202) human epitope
               DLNTMLNTVGGHQAAMQMLKETINEEAAEWDR Gag(183-214) human epitope
                LNMMLNIVG Gag(184-192) human epitope
                LNTMLNTGVGHQAAM Gag(184-198) human epitope
                 NTMLNTVGGHQAAM Gag(185-198) human epitope
                 NTMLNTVGGHQAAMQMLK Gag(185-202) human epitope
                  MMLNIVGGH Gag(186-194) human epitope
                    LNIVGGHQA Gag(188-196) human epitope
                     NTVGGHQAAMQMLKE Gag(189-203) A2 human epitope
                     NTVGGHQAAMQMLKE Gag(189-203) human epitope
                      IVGGHQAAM Gag(190-198) B*07:02 human epitope
                       VGGHQAAMQMLKET Gag(191-204) human epitope
                       VGGHQAAMQMLKDTI Gag(191-205) H-2Dd mouse epitope
                       VGGHQAAMQMLKDTI Gag(191-205) human epitope
                       VGGHQAAMQMLKDTINEEAAEWDR Gag(191-214) human, macaque epitope
                       VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) human, macaque epitope
                       VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) macaque epitope
                       VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) mouse epitope
                       VGGHQAAMQMLKdTINEEAAEWDR Gag(191-214) subtype-specific susceptible form
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health