HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

EKAFSPEVIPMFSALSEGAT Gag(161-180) B*57:01 human epitope
EKAFSPEVPMFTALSEGAT Gag(161-180) human epitope
  AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
  AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
  AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
  AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
   FSPEVIPMFSALSEGATP Gag(164-181) human epitope
   FSPEVIPMFSALSEGATP Gag(164-181) human epitope
     PEVIPMFSALSEGATP Gag(166-181) epitope
      EVIPMFTALSEGATP Gag(167-181) human epitope
      EVIPMFSALSEGATP Gag(167-181) human epitope
       VIPMFTALSEGATPQDLN Gag(168-185) human, macaque epitope
       VIPMFSALSEGATPQDLN Gag(168-185) human, macaque epitope
       VIPMFSALSEGATPQDLN Gag(168-185) mouse epitope
       VIPMFtALSEGATPQDLN Gag(168-185) subtype-specific susceptible form
       VIPMFSALSEGATPQDLN Gag(168-185) macaque epitope
        IPMFSALSEGATPQD Gag(169-183) A2, B44 human epitope
        IPMFSALSEGATPQDL Gag(169-184) B12 human epitope
        IPMFSALSEGATPQDL Gag(169-184) B44 human epitope
        IPMFSALSEGATPDQL Gag(169-184) B44 human epitope
         PMFTALSEGAT Gag(170-180) human epitope
         PMFTALSEGATPQDLNTM Gag(170-187) C*08 human epitope
         PMFSALSEGATPQDLNTM Gag(170-187) human epitope
         PMFSALSEGATPQDLNTM Gag(170-187) human epitope
         PMFSALSEGATPQDLNTM Gag(170-187) human epitope
         PMFtALSEGATPQDLNTM Gag(170-187) subtype-specific susceptible form
          MFSALSEGATPHDLN Gag(171-185) human epitope
          MFTALSEGTPQDLNTMLNT Gag(171-190) human epitope
           FSALSEGAT Gag(172-180) human epitope
           FSALSEGATPQDLNT Gag(172-186) human epitope
            TALSEGATP Gag(173-181) E*01:03 human epitope
            SALSEGATPQDLNTM Gag(173-187) B44 human epitope
            SALSEGATPQDLNTM Gag(173-187) human epitope
            SALSEGATPQDLNTML Gag(173-188) human epitope
            QALSEGCTPYDINQML Gag(173-188) human epitope
            SALSEGATPQDLNMMLNIVG Gag(173-192) B*81:01 human epitope
            SALSEGATPQDLNtMLNtVG Gag(173-192) observed variant
            SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
            SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
            SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
            SALSEGATPQDLNmMLNiVG Gag(173-192) observed variant
            tALSEGATPQDLNTMLNTVG Gag(173-192) inferred escape
            SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
            SALSEGATPQDLNTMLNTVGGH Gag(173-194) B14 human epitope
             ALSEGATPQDL Gag(174-184) human epitope
             ALSEGATPQDLNMM Gag(174-187) human epitope
              LSEGATPQD Gag(175-183) human epitope
              LSEGATPQDL Gag(175-184) B42, B44 human epitope
              LSEGATPQDL Gag(175-184) B*44:03 human epitope
              LSEGATPQDLNTMLN Gag(175-189) human epitope
               SEGATPQDL Gag(176-184) B*35:02, B*35:03, B*53:01 human epitope
               SEGATPQDL Gag(176-184) B*40 human epitope
               SEGATPQDL Gag(176-184) B40 human epitope
               SEGATPQDL Gag(176-184) B40 human epitope
               SEGATPQDL Gag(176-184) B40 human epitope
               SEGATPQDL Gag(176-184) B*40:01 human epitope
               SEGATPQDL Gag(176-184) B*40:01 human epitope
               SEGATPQDL Gag(176-184) B*44 human epitope
               SEGATPQDL Gag(176-184) B*44 human epitope
               SEGATPQDL Gag(176-184) B44 human epitope
               SEGATPQDL Gag(176-184) B*55 human epitope
               SEGATPQDL Gag(176-184) B*60, B*61 human epitope
               SEGATPQDL Gag(176-184) B60 human epitope
               SEGATPQDL Gag(176-184) B60 human epitope
               SEGATPQDL Gag(176-184) B60 human epitope
               SEGATPQDL Gag(176-184) B60 human epitope
               SEGATPQDL Gag(176-184) B60 human epitope
               SEGATPQDL Gag(176-184) human epitope
               SEGATPQDLNTMLNT Gag(176-190) human epitope
                EGATPQDLNTM Gag(177-187) B*67:01 human, mouse epitope
                EGATPQDLNmM Gag(177-187)
                EGATPQDLNMM Gag(177-187) B*67:01 human, mouse epitope
                EGATPQDLNtM Gag(177-187)
                EGATPQDLNMML Gag(177-188) human epitope
                EGATPQDLNTMLNTV Gag(177-191) B*57 human epitope
                EGATPQDLNTMLNTV Gag(177-191) B7 human epitope
                EGATPQDLNTMLNTV Gag(177-191) human epitope
                EGATPQDLNTMLNTVG Gag(177-192) human epitope
                 GATPQDLNM Gag(178-186) human epitope
                 GATPQDLNMMLNIV Gag(178-191) human epitope
                 GATPQDLNTMLNTV Gag(178-191) human epitope
                 GATPQDLNTMLNTVGGH Gag(178-194) human epitope
                 GATPQDLNTMLNTVGGH Gag(178-194) human epitope
                  ATPQDLNTM Gag(179-187) B7 human epitope
                  CTPYDINQM Gag(179-187) Mamu A*01 macaque epitope
                  CTPYDINQM Gag(179-187) Mamu A*01 macaque epitope
                  ATPQDLNTML Gag(179-188) B*07, B*58 human epitope
                  ATPQDLNMML Gag(179-188) B53 human epitope
                  CTPYDINQML Gag(179-188) macaque epitope
                  ATPQDLNTMLNT Gag(179-190) B58 human epitope
                  CTPYDINQMLNC Gag(179-190) B58 human epitope
                  ATPQDLNTMLNT Gag(179-190) B*58:02 human epitope
                  ATPQDLNTMLNTVGG Gag(179-193) human epitope
                   TPQDLNTM Gag(180-187) B*07 human epitope
                   TPQDLNTM Gag(180-187) B*07 human, transgenic mouse epitope
                   TPQDLNTM Gag(180-187) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) A*29 human epitope
                   TPQDLNTML Gag(180-188) B*07 human epitope
                   TPQDLNTML Gag(180-188) B*07 human epitope
                   TPQDLNTML Gag(180-188) B*07 human, transgenic mouse epitope
                   TPQDLNTML Gag(180-188) B*07, B*53:01, B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*07:02 human epitope
                   TPQDLNTML Gag(180-188) B*07:02 human epitope
                   TPQDLNMML Gag(180-188) B*07:02 human epitope
                   TPQDLNTML Gag(180-188) B*07:02 human epitope
                   TPQDLNTML Gag(180-188) B*07:02, B*39:10, B*42:01, B*81:01, C*08:02 human epitope
                   TPtDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                   TPeDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                   TPgDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                   TPsDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                   TPQDLNsML Gag(180-188) escape documented in this paper; replicative capacity reduced
                   TPQDLNTML Gag(180-188) B*07:02, B*42:01, B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*07:02, B*42:01, B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*14 human epitope
                   TPQDLNTML Gag(180-188) B*35, B*53 human epitope
                   TPhDLNTML Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) B*35:02, B*35:03, B*53:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01, B*81:01, B39, C*08:02 human epitope
                   TPQDLNTML Gag(180-188) B39, B7 human epitope
                   TPQDLNTML Gag(180-188) B*39:10 human epitope
                   TPQDLNTML Gag(180-188) B*39:10 human epitope
                   TPQDLNTML Gag(180-188) B*39:10 human epitope
                   TPQDLNTML Gag(180-188) B*39:10, B*81:01 human epitope
                   TPtDLNTML{...h...t} Gag(180-188) observed variant
                   TPsDLNTML{...h...t} Gag(180-188) observed variant
                   TPQDLNTML{...a} Gag(180-188) observed variant
                   TPsDLNTML{...a...v} Gag(180-188) observed variant
                   {d...}aPsDLNsML{...a} Gag(180-188) observed variant
                   {d...}TPsDLNsML{...v} Gag(180-188) observed variant
                   {d...}TPsDLNsML{...q...v} Gag(180-188) observed variant
                   TPaDLNTML{...v...v} Gag(180-188) observed variant
                   TPgDLNTML{...v...v} Gag(180-188) observed variant
                   TPhDLNTML{...i} Gag(180-188) observed variant
                   TPtDLNTML{...i} Gag(180-188) observed variant
                   TPaDLNTML{...i} Gag(180-188) observed variant
                   TPsDLNTML{...i} Gag(180-188) observed variant
                   TPsDLNsML Gag(180-188) observed variant
                   TPsDLNsML{...t} Gag(180-188) observed variant
                   TPtDLNTML{...v} Gag(180-188) observed variant
                   TPQDLNTMf{...q...v...i} Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) B*40 human epitope
                   TPQDLNTML Gag(180-188) B*42 human epitope
                   TPQDLNTML Gag(180-188) B*42 human epitope
                   TPQDLNTML Gag(180-188) B*42 human epitope
                   TPQDLNTML Gag(180-188) B*42, B*81 human epitope
                   TPQDLNMML Gag(180-188) B*42, B*81 human epitope
                   TPQDLNTML Gag(180-188) B*42, B*81 human epitope
                   TPQDLNTML Gag(180-188) B*42, C*08 human epitope
                   TPQDLNTML Gag(180-188) B42 human epitope
                   TPQDLNTML Gag(180-188) B42 human epitope
                   TPQDLNTML Gag(180-188) B42 human epitope
                   TPQDLNTML Gag(180-188) B42, B53, B7, B81 human epitope
                   TPQDLNTML Gag(180-188) B42, B7 human epitope
                   TPQDLNTML Gag(180-188) B42, B7, B81 human epitope
                   TPQDLNmML Gag(180-188) diminished response
                   TPQDLNTML Gag(180-188) B42, B7, Cw8 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPtDLNTML Gag(180-188) literature escape
                   TPaDLNTML Gag(180-188) observed variant
                   TPsDLNTML Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTNL Gag(180-188) B*42:01 human epitope
                   TPTDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPxDLNTML Gag(180-188) escape documented in this paper
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPtDLNTML Gag(180-188) escape documented in this paper; observed variant
                   TPQDLNTML Gag(180-188) B*42:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01, B*42:02, B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                   TPQDLNMML Gag(180-188) B*42:01, B*81:01 human epitope
                   iPQDLNMML Gag(180-188) HLA association; observed variant
                   iPhDLNMML Gag(180-188) HLA association; observed variant
                   TPsDLNMML Gag(180-188) HLA association; observed variant
                   TPhDLNMML Gag(180-188) HLA association; observed variant
                   TPQDLNvML Gag(180-188) HLA association; observed variant
                   TPgDLNMML Gag(180-188) HLA association; observed variant
                   TPQDLNtML Gag(180-188) HLA association; observed variant
                   TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                   TPQDLNsML Gag(180-188) HLA association; observed variant
                   TPsDLNsML Gag(180-188) HLA association; observed variant
                   TPaDLNTML Gag(180-188) HLA association; observed variant
                   TPtDLNTML Gag(180-188) HLA association; observed variant
                   TPgDLNTML Gag(180-188) HLA association; observed variant
                   TPQDLNMML Gag(180-188) B*42:02 human epitope
                   TPQDLNtML Gag(180-188) subtype-specific non-susceptible form; subtype-specific susceptible form
                   TPQDLNMML Gag(180-188) B*53 human epitope
                   TPYDINQML Gag(180-188) B*53 human epitope
                   TPYDINQML Gag(180-188) B53 human epitope
                   TPQDLNMML Gag(180-188) B53 human epitope
                   TPQDLNTML Gag(180-188) B53 human epitope
                   TPYDINQML Gag(180-188) B53 human epitope
                   TPQDLNQML Gag(180-188) B53 human epitope
                   TPQDLNMML Gag(180-188) B53 human epitope
                   TPQDLNtML Gag(180-188) subtype-specific non-susceptible form; TCR related mutation
                   TPQDLNMML Gag(180-188) B53 human epitope
                   TPYDINQML Gag(180-188) B53 human epitope
                   TPQDLNMML Gag(180-188) B53 human epitope
                   TPYDINQML Gag(180-188) B*53:01 human epitope
                   TPYDINQML Gag(180-188) B*53:01 human epitope
                   TPQDLNMML Gag(180-188) B*53:01 human epitope
                   TPYDINQML Gag(180-188) B*58:01 human epitope
                   TPQDLNTML Gag(180-188) B*67:01 human, mouse epitope
                   TPQDLNmML Gag(180-188)
                   TPQDLNMML Gag(180-188) B*67:01 human, mouse epitope
                   TPQDLNtML Gag(180-188)
                   TPQDLNTML Gag(180-188) B*67:01 human epitope
                   TPQDLNTML Gag(180-188) B*67:01 human epitope
                   TPQDLNTML Gag(180-188) B*67:01 human epitope
                   TPsDLNlML Gag(180-188) non-susceptible form; observed variant
                   TPaDLNlML Gag(180-188) non-susceptible form; observed variant
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B7 human epitope
                   TPQDLNTML Gag(180-188) B*81 human epitope
                   TPQDLNTML Gag(180-188) B*81 human epitope
                   TPQDLNTML Gag(180-188) B*81 human epitope
                   TPQDLNTML Gag(180-188) B*81 human epitope
                   TPQDmNTML Gag(180-188) calculated escape
                   TPQDsNTML Gag(180-188) calculated escape
                   TPQDyNTML Gag(180-188) calculated escape
                   TPQDLNTML Gag(180-188) B*81 human epitope
                   TPQDLNTML? Gag(180-188) B81 human epitope
                   TPQDLNTML Gag(180-188) B81 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPeDLNTML Gag(180-188) observed variant
                   TPsDLNsML Gag(180-188) observed variant
                   TPQDLNmML Gag(180-188) observed variant
                   TPsDLNTMf Gag(180-188) observed variant
                   TPQDLNaML Gag(180-188) observed variant
                   TPrDLNmML Gag(180-188) observed variant
                   TPaDLNTML Gag(180-188) observed variant
                   TPrDLNTML Gag(180-188) observed variant
                   TPgDLNTML Gag(180-188) observed variant
                   TPQDLNTfL Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNTML Gag(180-188) B*81:01 human epitope
                   TPQDLNmML Gag(180-188) literature escape
                   TPgDLNTML Gag(180-188) observed variant
                   TPQDLNsML Gag(180-188) observed variant
                   TPsDLNTML Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) C*08 human epitope
                   TPQDLNTML Gag(180-188) C*08 human epitope
                   TPQDLNTML Gag(180-188) C*08 human epitope
                   TPQDLNTML Gag(180-188) C*08 human epitope
                   TPQDLNTML Gag(180-188) C*08:02 human epitope
                   TPQDLNTML Gag(180-188) C*08:02 human epitope
                   TPQDLNTML Gag(180-188) C*08:02 human epitope
                   TPQDLNTML Gag(180-188) C*12 human epitope
                   TPQDLNTML Gag(180-188) C*14 human epitope
                   TPQDLNTML Gag(180-188) C*17 human epitope
                   TPQDLNTML Gag(180-188) Cw8 human epitope
                   TPQDLNTML Gag(180-188) Cw8 human epitope
                   TPYDINQML Gag(180-188) human epitope
                   TPqDlNtML Gag(180-188) observed variant
                   TPqDlNmML Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) human epitope
                   TPQDLNsML Gag(180-188) escape documented in this paper
                   TPtDLNTML Gag(180-188) escape documented in this paper
                   TPsDLNTML Gag(180-188) escape documented in this paper
                   TPpDLNTML Gag(180-188) observed variant
                   TPaDLNTML Gag(180-188) escape documented in this paper
                   TPvDLNTML Gag(180-188) observed variant
                   TPhDLNTML Gag(180-188) observed variant
                   TPQDLNmML Gag(180-188) escape documented in this paper
                   TsQDLNTML Gag(180-188) observed variant
                   TPeDLNTML Gag(180-188) observed variant
                   TPsDLNsML Gag(180-188) observed variant
                   TPgDLNTML Gag(180-188) observed variant
                   aPQDLNTMv Gag(180-188) observed variant
                   nPQDLNTML Gag(180-188) observed variant
                   TPsDLNTMf Gag(180-188) observed variant
                   TPQDLyTML Gag(180-188) observed variant
                   TPQDLNTfL Gag(180-188) observed variant
                   TPQDLNTvL Gag(180-188) observed variant
                   TqQDLNpML Gag(180-188) observed variant
                   aPQDLNTML Gag(180-188) observed variant
                   TPYDINQML Gag(180-188) human epitope
                   TPQDLNTML Gag(180-188) human epitope
                   TPYDINQML Gag(180-188) human epitope
                   TPQDLNTML Gag(180-188) human epitope
                   TPQDLNTML Gag(180-188) human epitope
                   TPQDLNTML Gag(180-188) human epitope
                   TPyDiNqML Gag(180-188) observed variant
                   TPQDLNmML Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) human epitope
                   TPQDLNMML Gag(180-188) human epitope
                   TPQDLNtML Gag(180-188) observed variant
                   TPyDiNqML Gag(180-188) observed variant
                   TPQDLNTML Gag(180-188) human epitope
                   TPQDLNTMLN Gag(180-189) B14, B7 human epitope
                   TPQDLNMMLN Gag(180-189) B7 human epitope
                   TPQDLNMMLN Gag(180-189) B7 human epitope
                   TPQDLNTMLN Gag(180-189) B7 human epitope
                   TPQDLNTMLNT Gag(180-190) B14 human epitope
                   TPQDLNQMLNTV Gag(180-191) B58 human epitope
                   TPQDLNtMLNTV Gag(180-191) observed variant
                   TPQDLNMMLNIVGGH Gag(180-194) human epitope
                   TPQDLNTMLNTVGGH Gag(180-194) human epitope
                   TPQDLNTMLNTVGGH Gag(180-194) human epitope
                   TPQDLNTMLNTVGGHQAA Gag(180-197) human epitope
                    PQDLNTMLN Gag(181-189) B14, Cw8 human epitope
                    PQDLNTMLN Gag(181-189) Cw7 human epitope
                    PQDLNTMLNTV Gag(181-191) B14 human epitope
                    PQDLNTMLNTVGGHQ Gag(181-195) A2 human epitope
                    PQDLNTMLNTVGGHQ Gag(181-195) human epitope
                      DLNTMLNTV Gag(183-191) B*14 human epitope
                      DLNMMLNIV Gag(183-191) B14 human epitope
                      DLNMMLNIV Gag(183-191) B14 human epitope
                      DLNMtLNvV Gag(183-191) susceptible form
                      DLNMMLNIV Gag(183-191) B14 human epitope
                      DLNMMLNIV Gag(183-191) B14 human epitope
                      DLNTMLNTV Gag(183-191) B14, Cw8 human epitope
                      DLNTMLNTV Gag(183-191) B14, Cw8 human epitope
                      DLNmMLNiV Gag(183-191) observed variant
                      DLNTMLNTV Gag(183-191) B*14:02, Cw8 human epitope
                      DLNnMLNiV Gag(183-191) susceptible form
                      DLNTMLNTV Gag(183-191) Cw8 human epitope
                      DLNTMLNTV Gag(183-191) chimpanzee epitope
                      DLNTMLNTVG Gag(183-192) A2, B14 human epitope
                      DLNTMLNTVGGHQAAMQMLK Gag(183-202) human epitope
                      DLNTMLNTVGGHQAAMQMLKETINEEAAEWDR Gag(183-214) human epitope
                       LNMMLNIVG Gag(184-192) human epitope
                       LNTMLNTGVGHQAAM Gag(184-198) human epitope
                        NTMLNTVGGHQAAM Gag(185-198) human epitope
                        NTMLNTVGGHQAAMQMLK Gag(185-202) human epitope
                         MMLNIVGGH Gag(186-194) human epitope
                           LNIVGGHQA Gag(188-196) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health