HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

NAWVKVVEEKAFSPEVIPMFSA Gag(153-174) B57 human epitope
   VKVIEEKAFSPEVIPMFT Gag(156-173) human epitope
     VVEEKAFSPEVIPMFSALS Gag(158-176) macaque epitope
      MEEKAFSPEVIPMFT Gag(159-173) human epitope
       EEKAFSPEVIPMFSA Gag(160-174) human epitope
       EEKAFSPEVIPMFSA Gag(160-174) human epitope
       EEKAFSPEVIPMFSALSEGA Gag(160-179) B27 human epitope
        EKAFSPEVIPMFSAL Gag(161-175) human epitope
        EKAFSPEVIPMFSAL Gag(161-175) human epitope
        EKGFNPEVIPMFSAL Gag(161-175) human epitope
        EKAFSPEVIPMFSAL Gag(161-175) human epitope
        EKAFSPEVIPMFSALSEGAT Gag(161-180) B*57:01 human epitope
        EKAFSPEVPMFTALSEGAT Gag(161-180) human epitope
          AFSPEVIPMFT Gag(163-173) human epitope
          AFSPEVIPMFSALS Gag(163-176) human epitope
          AFSPEVIPMFTALSE Gag(163-177) human epitope
          AFSPEVIPMFTALSE Gag(163-177) human epitope
          AFSPEVIPMFTALSEGA Gag(163-179) C*14 human epitope
          AFSPEVIPMFSALSEGA Gag(163-179) human epitope
          AFSPEVIPMFSALSEGA Gag(163-179) human epitope
          AFSPEVIPMFSALSEGA Gag(163-179) human epitope
          AFSPEVIPMFtALSEGA Gag(163-179) subtype-specific susceptible form
          AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
          AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
          AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
          AFSPEVIPMFSALSEGATPQ Gag(163-182) human epitope
           FSPEVIPMFS Gag(164-173) C*03:04 human epitope
           FSPEVIPMFSALSEGATP Gag(164-181) human epitope
           FSPEVIPMFSALSEGATP Gag(164-181) human epitope
            SPEVIPMFASLSEGA Gag(165-179) A2 human epitope
            SPEVIPMFSALSEGA Gag(165-179) mouse epitope
            SPEVIPMFSALSEGA Gag(165-179) human epitope
            SPEVIPMFSALSEGA Gag(165-179) human epitope
             PEVIPMFSAL Gag(166-175) C*03:04 human epitope
             PEVIPMFaAL Gag(166-175) observed variant
             PEVIPMFmAL Gag(166-175) observed variant
             PEVIPMFtAL Gag(166-175) observed variant
             PEVIPMFSALSEGATP Gag(166-181) epitope
              EVIPMFSAL Gag(167-175) A*25 human epitope
              EVIPMFSAL Gag(167-175) A*26 human epitope
              EVIPMFSAL Gag(167-175) A*26 human epitope
              EVIPMFSAL Gag(167-175) A*26, A*26:01, A*26:02, A*26:03, C*01, C*01:02 human epitope
              EVIPMFtAL Gag(167-175) HLA association; processing
              EVIPMFTAL Gag(167-175) A*26, A*26:01, A*26:02, A*26:03, C*01, C*01:02 human epitope
              EVIPMFsAL Gag(167-175) HLA association; processing
              EVIPMFSAL Gag(167-175) A26 human epitope
              EVIPMFSAL Gag(167-175) A26 human epitope
              EVIPMFSAL Gag(167-175) A26 human epitope
              EVIPMFSAL Gag(167-175) A26 human epitope
              EVIPMFSAL Gag(167-175) A26 human epitope
              EVIPMFSAL Gag(167-175) A*26:01 epitope
              EVIPMFTAL Gag(167-175) A*26:01 human epitope
              EVIPMFSAL Gag(167-175) A*26:01 human epitope
              EVIPMFaAL Gag(167-175) observed variant
              EVIPMFtAL Gag(167-175) observed variant
              EVIPMFTAL Gag(167-175) A*26:01 human epitope
              EVIPMFSAL Gag(167-175) A*26:01 human epitope
              EVIPMFSAL Gag(167-175) A*26:01, A*26:02, A*26:03 human epitope
              EVIPMFSAL Gag(167-175) A*26:01, A*26:02, A*26:03 human epitope
              EVIPMFSAL Gag(167-175) A*26:01, A*26:03 human epitope
              EVIPMFaAL Gag(167-175) escape documented in this paper; TCR related mutation
              EVIPMFtAL Gag(167-175) escape documented in this paper; TCR related mutation
              kVIPMFSAL Gag(167-175) diminished HLA binding or increased off-rate
              EiIPMFSAL Gag(167-175) observed variant
              EVIPvFSAL Gag(167-175) observed variant
              gVIPMFSAL Gag(167-175) observed variant
              EgIPMFSAL Gag(167-175) observed variant
              EVIPMFpAL Gag(167-175) observed variant
              EiIPMFaAL Gag(167-175) observed variant
              EmIPMFaAL Gag(167-175) observed variant
              EVIPMFttL Gag(167-175) observed variant
              EiIPMFtAL Gag(167-175) observed variant
              EeIPMFtAL Gag(167-175) observed variant
              EVIPiFtAL Gag(167-175) observed variant
              EVIPvFtAL Gag(167-175) observed variant
              EiIPiFtAL Gag(167-175) observed variant
              EVIPMFSAL Gag(167-175) A*26:02 epitope
              EVIPMFSAL Gag(167-175) A*26:03 epitope
              EVIPMFTAL Gag(167-175) A*26:38 human epitope
              EVIPMFSAL Gag(167-175) C*01 human epitope
              EVIPMFSAL Gag(167-175) Cw3 human epitope
              EVIPMFAAL Gag(167-175) human epitope
              EVIPMFSAL Gag(167-175) human epitope
              EVIPMFSAL Gag(167-175) human epitope
              EVIPMFSAL Gag(167-175) human epitope
              EVIPMFSAL Gag(167-175) human epitope
              EVIPMFTALSEGATP Gag(167-181) human epitope
              EVIPMFSALSEGATP Gag(167-181) human epitope
               VIPMFSAL Gag(168-175) B*15:16 human epitope
               VIPMFSAL Gag(168-175) B*18 human epitope
               VIPMFSAL Gag(168-175) C*01 human epitope
               VIPMFSAL Gag(168-175) C*01 human epitope
               VIPMFSAL Gag(168-175) C*01:02 human epitope
               VIPMFSAL Gag(168-175) C*01:02 human epitope
               VIPMSFAL Gag(168-175) C*01:02 human epitope
               VIPMtFAL Gag(168-175) HLA association; diminished response; escape documented in this paper
               VIPMFSAL Gag(168-175) C*01:02 human epitope
               VIPMFSAL Gag(168-175) C*01:02 human epitope
               VIPMFSAL Gag(168-175) C*01:02 human epitope
               VIPMFSAL Gag(168-175) C*01:02, Cw1 human epitope
               VIPMFSAL Gag(168-175) C*14 human epitope
               VIPMFSAL Gag(168-175) Cw1 human epitope
               VIPMFSAL Gag(168-175) Cw1 human epitope
               VIPMFSAL Gag(168-175) Cw1, Cw2 human epitope
               VIPMFSAL Gag(168-175) human epitope
               VIPMFSAL Gag(168-175) human epitope
               VIPMFAAL Gag(168-175) human epitope
               VIPMFSAL Gag(168-175) human epitope
               VIPMFSALS Gag(168-176) human epitope
               VIPMFSALSEGATPQDLN Gag(168-185) macaque epitope
               VIPMFSALSEGATPQDLN Gag(168-185) mouse epitope
               VIPMFtALSEGATPQDLN Gag(168-185) subtype-specific susceptible form
               VIPMFSALSEGATPQDLN Gag(168-185) human, macaque epitope
               VIPMFTALSEGATPQDLN Gag(168-185) human, macaque epitope
                IPMFSALSEG Gag(169-178) B7 human epitope
                IPMFSALSEGATPQD Gag(169-183) A2, B44 human epitope
                IPMFSALSEGATPQDL Gag(169-184) B12 human epitope
                IPMFSALSEGATPDQL Gag(169-184) B44 human epitope
                IPMFSALSEGATPQDL Gag(169-184) B44 human epitope
                 PMFSALSEG Gag(170-178) human epitope
                 PMFTALSEGAT Gag(170-180) human epitope
                 PMFTALSEGATPQDLNTM Gag(170-187) C*08 human epitope
                 PMFSALSEGATPQDLNTM Gag(170-187) human epitope
                 PMFSALSEGATPQDLNTM Gag(170-187) human epitope
                 PMFtALSEGATPQDLNTM Gag(170-187) subtype-specific susceptible form
                 PMFSALSEGATPQDLNTM Gag(170-187) human epitope
                  MFSALSEGA Gag(171-179) H-2d mouse epitope
                  MFSALSEGATPHDLN Gag(171-185) human epitope
                  MFTALSEGTPQDLNTMLNT Gag(171-190) human epitope
                   FSALSEGAT Gag(172-180) human epitope
                   FSALSEGATPQDLNT Gag(172-186) human epitope
                    TALSEGATP Gag(173-181) E*01:03 human epitope
                    SALSEGATPQDLNTM Gag(173-187) B44 human epitope
                    SALSEGATPQDLNTM Gag(173-187) human epitope
                    QALSEGCTPYDINQML Gag(173-188) human epitope
                    SALSEGATPQDLNTML Gag(173-188) human epitope
                    SALSEGATPQDLNMMLNIVG Gag(173-192) B*81:01 human epitope
                    SALSEGATPQDLNtMLNtVG Gag(173-192) observed variant
                    SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
                    SALSEGATPQDLNmMLNiVG Gag(173-192) observed variant
                    tALSEGATPQDLNTMLNTVG Gag(173-192) inferred escape
                    SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
                    SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
                    SALSEGATPQDLNTMLNTVG Gag(173-192) human epitope
                    SALSEGATPQDLNTMLNTVGGH Gag(173-194) B14 human epitope
                     ALSEGATPQDL Gag(174-184) human epitope
                     ALSEGATPQDLNMM Gag(174-187) human epitope
                      LSEGATPQD Gag(175-183) human epitope
                      LSEGATPQDL Gag(175-184) B42, B44 human epitope
                      LSEGATPQDL Gag(175-184) B*44:03 human epitope
                      LSEGATPQDLNTMLN Gag(175-189) human epitope
                       SEGATPQDL Gag(176-184) B*35:02, B*35:03, B*53:01 human epitope
                       SEGATPQDL Gag(176-184) B*40 human epitope
                       SEGATPQDL Gag(176-184) B40 human epitope
                       SEGATPQDL Gag(176-184) B40 human epitope
                       SEGATPQDL Gag(176-184) B40 human epitope
                       SEGATPQDL Gag(176-184) B*40:01 human epitope
                       SEGATPQDL Gag(176-184) B*40:01 human epitope
                       SEGATPQDL Gag(176-184) B*44 human epitope
                       SEGATPQDL Gag(176-184) B*44 human epitope
                       SEGATPQDL Gag(176-184) B44 human epitope
                       SEGATPQDL Gag(176-184) B*55 human epitope
                       SEGATPQDL Gag(176-184) B*60, B*61 human epitope
                       SEGATPQDL Gag(176-184) B60 human epitope
                       SEGATPQDL Gag(176-184) B60 human epitope
                       SEGATPQDL Gag(176-184) B60 human epitope
                       SEGATPQDL Gag(176-184) B60 human epitope
                       SEGATPQDL Gag(176-184) B60 human epitope
                       SEGATPQDL Gag(176-184) human epitope
                       SEGATPQDLNTMLNT Gag(176-190) human epitope
                        EGATPQDLNMM Gag(177-187) B*67:01 human, mouse epitope
                        EGATPQDLNtM Gag(177-187)
                        EGATPQDLNTM Gag(177-187) B*67:01 human, mouse epitope
                        EGATPQDLNmM Gag(177-187)
                        EGATPQDLNMML Gag(177-188) human epitope
                        EGATPQDLNTMLNTV Gag(177-191) B*57 human epitope
                        EGATPQDLNTMLNTV Gag(177-191) B7 human epitope
                        EGATPQDLNTMLNTV Gag(177-191) human epitope
                        EGATPQDLNTMLNTVG Gag(177-192) human epitope
                         GATPQDLNM Gag(178-186) human epitope
                         GATPQDLNTMLNTV Gag(178-191) human epitope
                         GATPQDLNMMLNIV Gag(178-191) human epitope
                         GATPQDLNTMLNTVGGH Gag(178-194) human epitope
                         GATPQDLNTMLNTVGGH Gag(178-194) human epitope
                          ATPQDLNTM Gag(179-187) B7 human epitope
                          CTPYDINQM Gag(179-187) Mamu A*01 macaque epitope
                          CTPYDINQM Gag(179-187) Mamu A*01 macaque epitope
                          ATPQDLNTML Gag(179-188) B*07, B*58 human epitope
                          ATPQDLNMML Gag(179-188) B53 human epitope
                          CTPYDINQML Gag(179-188) macaque epitope
                          ATPQDLNTMLNT Gag(179-190) B58 human epitope
                          CTPYDINQMLNC Gag(179-190) B58 human epitope
                          ATPQDLNTMLNT Gag(179-190) B*58:02 human epitope
                          ATPQDLNTMLNTVGG Gag(179-193) human epitope
                           TPQDLNTM Gag(180-187) B*07 human epitope
                           TPQDLNTM Gag(180-187) B*07 human, transgenic mouse epitope
                           TPQDLNTM Gag(180-187) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) A*29 human epitope
                           TPQDLNTML Gag(180-188) B*07 human epitope
                           TPQDLNTML Gag(180-188) B*07 human, transgenic mouse epitope
                           TPQDLNTML Gag(180-188) B*07 human epitope
                           TPQDLNTML Gag(180-188) B*07, B*53:01, B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*07:02 human epitope
                           TPQDLNTML Gag(180-188) B*07:02 human epitope
                           TPQDLNTML Gag(180-188) B*07:02 human epitope
                           TPQDLNMML Gag(180-188) B*07:02 human epitope
                           TPQDLNTML Gag(180-188) B*07:02, B*39:10, B*42:01, B*81:01, C*08:02 human epitope
                           TPtDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                           TPeDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                           TPgDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                           TPsDLNTML Gag(180-188) escape documented in this paper; replicative capacity reduced
                           TPQDLNsML Gag(180-188) escape documented in this paper; replicative capacity reduced
                           TPQDLNTML Gag(180-188) B*07:02, B*42:01, B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*07:02, B*42:01, B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*14 human epitope
                           TPQDLNTML Gag(180-188) B*35, B*53 human epitope
                           TPhDLNTML Gag(180-188) observed variant
                           TPQDLNTML Gag(180-188) B*35:02, B*35:03, B*53:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01, B*81:01, B39, C*08:02 human epitope
                           TPQDLNTML Gag(180-188) B39, B7 human epitope
                           TPQDLNTML Gag(180-188) B*39:10 human epitope
                           TPQDLNTML Gag(180-188) B*39:10 human epitope
                           TPQDLNTML Gag(180-188) B*39:10 human epitope
                           TPQDLNTML Gag(180-188) B*39:10, B*81:01 human epitope
                           TPtDLNTML{...h...t} Gag(180-188) observed variant
                           TPsDLNTML{...h...t} Gag(180-188) observed variant
                           TPQDLNTML{...a} Gag(180-188) observed variant
                           TPsDLNTML{...a...v} Gag(180-188) observed variant
                           {d...}aPsDLNsML{...a} Gag(180-188) observed variant
                           {d...}TPsDLNsML{...v} Gag(180-188) observed variant
                           {d...}TPsDLNsML{...q...v} Gag(180-188) observed variant
                           TPaDLNTML{...v...v} Gag(180-188) observed variant
                           TPgDLNTML{...v...v} Gag(180-188) observed variant
                           TPhDLNTML{...i} Gag(180-188) observed variant
                           TPtDLNTML{...i} Gag(180-188) observed variant
                           TPaDLNTML{...i} Gag(180-188) observed variant
                           TPsDLNTML{...i} Gag(180-188) observed variant
                           TPsDLNsML Gag(180-188) observed variant
                           TPsDLNsML{...t} Gag(180-188) observed variant
                           TPtDLNTML{...v} Gag(180-188) observed variant
                           TPQDLNTMf{...q...v...i} Gag(180-188) observed variant
                           TPQDLNTML Gag(180-188) B*40 human epitope
                           TPQDLNTML Gag(180-188) B*42 human epitope
                           TPQDLNTML Gag(180-188) B*42 human epitope
                           TPQDLNTML Gag(180-188) B*42 human epitope
                           TPQDLNTML Gag(180-188) B*42, B*81 human epitope
                           TPQDLNMML Gag(180-188) B*42, B*81 human epitope
                           TPQDLNTML Gag(180-188) B*42, B*81 human epitope
                           TPQDLNTML Gag(180-188) B*42, C*08 human epitope
                           TPQDLNTML Gag(180-188) B42 human epitope
                           TPQDLNTML Gag(180-188) B42 human epitope
                           TPQDLNTML Gag(180-188) B42 human epitope
                           TPQDLNTML Gag(180-188) B42, B53, B7, B81 human epitope
                           TPQDLNTML Gag(180-188) B42, B7 human epitope
                           TPQDLNTML Gag(180-188) B42, B7, B81 human epitope
                           TPQDLNmML Gag(180-188) diminished response
                           TPQDLNTML Gag(180-188) B42, B7, Cw8 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPxDLNTML Gag(180-188) escape documented in this paper
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPtDLNTML Gag(180-188) literature escape
                           TPaDLNTML Gag(180-188) observed variant
                           TPsDLNTML Gag(180-188) observed variant
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPTDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPtDLNTML Gag(180-188) escape documented in this paper; observed variant
                           TPQDLNTML Gag(180-188) B*42:01 human epitope
                           TPQDLNTNL Gag(180-188) B*42:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01, B*42:02, B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                           TPQDLNMML Gag(180-188) B*42:01, B*81:01 human epitope
                           iPQDLNMML Gag(180-188) HLA association; observed variant
                           iPhDLNMML Gag(180-188) HLA association; observed variant
                           TPsDLNMML Gag(180-188) HLA association; observed variant
                           TPhDLNMML Gag(180-188) HLA association; observed variant
                           TPQDLNvML Gag(180-188) HLA association; observed variant
                           TPgDLNMML Gag(180-188) HLA association; observed variant
                           TPQDLNtML Gag(180-188) HLA association; observed variant
                           TPQDLNTML Gag(180-188) B*42:01, B*81:01 human epitope
                           TPQDLNsML Gag(180-188) HLA association; observed variant
                           TPsDLNsML Gag(180-188) HLA association; observed variant
                           TPaDLNTML Gag(180-188) HLA association; observed variant
                           TPtDLNTML Gag(180-188) HLA association; observed variant
                           TPgDLNTML Gag(180-188) HLA association; observed variant
                           TPQDLNMML Gag(180-188) B*42:02 human epitope
                           TPQDLNtML Gag(180-188) subtype-specific non-susceptible form; subtype-specific susceptible form
                           TPYDINQML Gag(180-188) B*53 human epitope
                           TPQDLNMML Gag(180-188) B*53 human epitope
                           TPQDLNMML Gag(180-188) B53 human epitope
                           TPYDINQML Gag(180-188) B53 human epitope
                           TPQDLNTML Gag(180-188) B53 human epitope
                           TPQDLNMML Gag(180-188) B53 human epitope
                           TPQDLNQML Gag(180-188) B53 human epitope
                           TPYDINQML Gag(180-188) B53 human epitope
                           TPQDLNMML Gag(180-188) B53 human epitope
                           TPQDLNMML Gag(180-188) B53 human epitope
                           TPQDLNtML Gag(180-188) subtype-specific non-susceptible form; TCR related mutation
                           TPYDINQML Gag(180-188) B53 human epitope
                           TPYDINQML Gag(180-188) B*53:01 human epitope
                           TPYDINQML Gag(180-188) B*53:01 human epitope
                           TPQDLNMML Gag(180-188) B*53:01 human epitope
                           TPYDINQML Gag(180-188) B*58:01 human epitope
                           TPQDLNTML Gag(180-188) B*67:01 human epitope
                           TPsDLNlML Gag(180-188) non-susceptible form; observed variant
                           TPaDLNlML Gag(180-188) non-susceptible form; observed variant
                           TPQDLNTML Gag(180-188) B*67:01 human epitope
                           TPQDLNTML Gag(180-188) B*67:01 human, mouse epitope
                           TPQDLNmML Gag(180-188)
                           TPQDLNTML Gag(180-188) B*67:01 human epitope
                           TPQDLNMML Gag(180-188) B*67:01 human, mouse epitope
                           TPQDLNtML Gag(180-188)
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B7 human epitope
                           TPQDLNTML Gag(180-188) B*81 human epitope
                           TPQDmNTML Gag(180-188) calculated escape
                           TPQDsNTML Gag(180-188) calculated escape
                           TPQDyNTML Gag(180-188) calculated escape
                           TPQDLNTML Gag(180-188) B*81 human epitope
                           TPQDLNTML Gag(180-188) B*81 human epitope
                           TPQDLNTML Gag(180-188) B*81 human epitope
                           TPQDLNTML Gag(180-188) B*81 human epitope
                           TPQDLNTML Gag(180-188) B81 human epitope
                           TPQDLNTML? Gag(180-188) B81 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNmML Gag(180-188) literature escape
                           TPgDLNTML Gag(180-188) observed variant
                           TPQDLNsML Gag(180-188) observed variant
                           TPsDLNTML Gag(180-188) observed variant
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPeDLNTML Gag(180-188) observed variant
                           TPsDLNsML Gag(180-188) observed variant
                           TPQDLNmML Gag(180-188) observed variant
                           TPsDLNTMf Gag(180-188) observed variant
                           TPQDLNaML Gag(180-188) observed variant
                           TPrDLNmML Gag(180-188) observed variant
                           TPaDLNTML Gag(180-188) observed variant
                           TPrDLNTML Gag(180-188) observed variant
                           TPgDLNTML Gag(180-188) observed variant
                           TPQDLNTfL Gag(180-188) observed variant
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) B*81:01 human epitope
                           TPQDLNTML Gag(180-188) C*08 human epitope
                           TPQDLNTML Gag(180-188) C*08 human epitope
                           TPQDLNTML Gag(180-188) C*08 human epitope
                           TPQDLNTML Gag(180-188) C*08 human epitope
                           TPQDLNTML Gag(180-188) C*08:02 human epitope
                           TPQDLNTML Gag(180-188) C*08:02 human epitope
                           TPQDLNTML Gag(180-188) C*08:02 human epitope
                           TPQDLNTML Gag(180-188) C*12 human epitope
                           TPQDLNTML Gag(180-188) C*14 human epitope
                           TPQDLNTML Gag(180-188) C*17 human epitope
                           TPQDLNTML Gag(180-188) Cw8 human epitope
                           TPQDLNTML Gag(180-188) Cw8 human epitope
                           TPYDINQML Gag(180-188) human epitope
                           TPqDlNtML Gag(180-188) observed variant
                           TPqDlNmML Gag(180-188) observed variant
                           TPYDINQML Gag(180-188) human epitope
                           TPQDLNTML Gag(180-188) human epitope
                           TPYDINQML Gag(180-188) human epitope
                           TPQDLNTML Gag(180-188) human epitope
                           TPQDLNTML Gag(180-188) human epitope
                           TPQDLNTML Gag(180-188) human epitope
                           TPQDLNTML Gag(180-188) human epitope
                           TPyDiNqML Gag(180-188) observed variant
                           TPQDLNmML Gag(180-188) observed variant
                           TPQDLNTML Gag(180-188) human epitope
                           TPQDLNsML Gag(180-188) escape documented in this paper
                           TPtDLNTML Gag(180-188) escape documented in this paper
                           TPsDLNTML Gag(180-188) escape documented in this paper
                           TPpDLNTML Gag(180-188) observed variant
                           TPaDLNTML Gag(180-188) escape documented in this paper
                           TPvDLNTML Gag(180-188) observed variant
                           TPhDLNTML Gag(180-188) observed variant
                           TPQDLNmML Gag(180-188) escape documented in this paper
                           TsQDLNTML Gag(180-188) observed variant
                           TPeDLNTML Gag(180-188) observed variant
                           TPsDLNsML Gag(180-188) observed variant
                           TPgDLNTML Gag(180-188) observed variant
                           aPQDLNTMv Gag(180-188) observed variant
                           nPQDLNTML Gag(180-188) observed variant
                           TPsDLNTMf Gag(180-188) observed variant
                           TPQDLyTML Gag(180-188) observed variant
                           TPQDLNTfL Gag(180-188) observed variant
                           TPQDLNTvL Gag(180-188) observed variant
                           TqQDLNpML Gag(180-188) observed variant
                           aPQDLNTML Gag(180-188) observed variant
                           TPQDLNMML Gag(180-188) human epitope
                           TPQDLNtML Gag(180-188) observed variant
                           TPyDiNqML Gag(180-188) observed variant
                           TPQDLNTML Gag(180-188) human epitope
                           TPQDLNTMLN Gag(180-189) B14, B7 human epitope
                           TPQDLNTMLN Gag(180-189) B7 human epitope
                           TPQDLNMMLN Gag(180-189) B7 human epitope
                           TPQDLNMMLN Gag(180-189) B7 human epitope
                           TPQDLNTMLNT Gag(180-190) B14 human epitope
                           TPQDLNQMLNTV Gag(180-191) B58 human epitope
                           TPQDLNtMLNTV Gag(180-191) observed variant
                           TPQDLNTMLNTVGGH Gag(180-194) human epitope
                           TPQDLNMMLNIVGGH Gag(180-194) human epitope
                           TPQDLNTMLNTVGGH Gag(180-194) human epitope
                           TPQDLNTMLNTVGGHQAA Gag(180-197) human epitope
                            PQDLNTMLN Gag(181-189) B14, Cw8 human epitope
                            PQDLNTMLN Gag(181-189) Cw7 human epitope
                            PQDLNTMLNTV Gag(181-191) B14 human epitope
                            PQDLNTMLNTVGGHQ Gag(181-195) A2 human epitope
                            PQDLNTMLNTVGGHQ Gag(181-195) human epitope
                              DLNTMLNTV Gag(183-191) B*14 human epitope
                              DLNMMLNIV Gag(183-191) B14 human epitope
                              DLNMtLNvV Gag(183-191) susceptible form
                              DLNMMLNIV Gag(183-191) B14 human epitope
                              DLNMMLNIV Gag(183-191) B14 human epitope
                              DLNMMLNIV Gag(183-191) B14 human epitope
                              DLNTMLNTV Gag(183-191) B14, Cw8 human epitope
                              DLNTMLNTV Gag(183-191) B14, Cw8 human epitope
                              DLNmMLNiV Gag(183-191) observed variant
                              DLNTMLNTV Gag(183-191) B*14:02, Cw8 human epitope
                              DLNnMLNiV Gag(183-191) susceptible form
                              DLNTMLNTV Gag(183-191) Cw8 human epitope
                              DLNTMLNTV Gag(183-191) chimpanzee epitope
                              DLNTMLNTVG Gag(183-192) A2, B14 human epitope
                              DLNTMLNTVGGHQAAMQMLK Gag(183-202) human epitope
                              DLNTMLNTVGGHQAAMQMLKETINEEAAEWDR Gag(183-214) human epitope
                               LNMMLNIVG Gag(184-192) human epitope
                               LNTMLNTGVGHQAAM Gag(184-198) human epitope
                                NTMLNTVGGHQAAM Gag(185-198) human epitope
                                NTMLNTVGGHQAAMQMLK Gag(185-202) human epitope
                                 MMLNIVGGH Gag(186-194) human epitope
                                   LNIVGGHQA Gag(188-196) human epitope
                                    NTVGGHQAAMQMLKE Gag(189-203) A2 human epitope
                                    NTVGGHQAAMQMLKE Gag(189-203) human epitope
                                     IVGGHQAAM Gag(190-198) B*07:02 human epitope
                                      VGGHQAAMQMLKET Gag(191-204) human epitope
                                      VGGHQAAMQMLKDTI Gag(191-205) H-2Dd mouse epitope
                                      VGGHQAAMQMLKDTI Gag(191-205) human epitope
                                      VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) macaque epitope
                                      VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) human, macaque epitope
                                      VGGHQAAMQMLKETINEEAAEWDR Gag(191-214) mouse epitope
                                      VGGHQAAMQMLKdTINEEAAEWDR Gag(191-214) subtype-specific susceptible form
                                      VGGHQAAMQMLKDTINEEAAEWDR Gag(191-214) human, macaque epitope
                                       GGHQAAMQMLK Gag(192-202) human epitope
                                       GGHQAAMQMLKDTIN Gag(192-206) human epitope
                                       GGHQAAMQMLKDTINEEEA Gag(192-210) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health