HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVG Pol(305-345) mouse epitope
        AIFQSSMTKILEPFRKQN Pol(313-330) human epitope
        AIFQSSMTKILEPFRKQNPDIVIYQ Pol(313-337) A11 human epitope
        AIFQSSMTKILEPFRKQNPDIVIYQ Pol(313-337) A11 human epitope
             SMTKILEPFRAQNPE Pol(318-332) human epitope
                KILEPFRKQNPDIVIYQY Pol(321-338) human epitope
                KILEPFRKQNPDIVIYQY Pol(321-338) human epitope
                 ILEPFRAQNPEIVIY Pol(322-336) human epitope
                 ILEPFRAQNPEIVIY Pol(322-336) human epitope
                 ILEPFRAQNPEIVIY Pol(322-336) human epitope
                     FRKQNPDIV Pol(326-334) human epitope
                     FRAQNPEIVIY Pol(326-336) human epitope
                     FRAQNPEIVIYQYMDKK Pol(326-342) human epitope
                     FRAQNPEIVIYQYMDKK Pol(326-342) human epitope
                     FRAQNPEIVIYQYMDKK Pol(326-342) human epitope
                      RAQNPEIVIY Pol(327-336) human epitope
                      RAQNPEIVIYQYMDDLYV Pol(327-344) C*12 human epitope
                       KQNPDIVIY Pol(328-336) A*30 human epitope
                       AQNPEIVIY Pol(328-336) A*30 human epitope
                       ArNPEIVIY Pol(328-336) observed variant
                       AkNPEIVIY Pol(328-336) observed variant
                       AQNPEIVIc Pol(328-336) observed variant
                       AQNPElVIY Pol(328-336) observed variant
                       tQNPEIVIY Pol(328-336) observed variant
                       KQNPDIVIY Pol(328-336) A30 human epitope
                       KQNPDIVIY Pol(328-336) A30 human epitope
                       AQNPEIVIY Pol(328-336) A*30:02 human epitope
                       KQNPDIVIY Pol(328-336) A*30:02 human epitope
                       KQNPDIVIY Pol(328-336) A*30:02 human epitope
                       KQNPDIVIY Pol(328-336) B*15:01 human epitope
                       KQNPDIVIY Pol(328-336) B*15:03 human epitope
                       KQNPDIVIY Pol(328-336) B*15:03 human epitope
                       KQNPeIVIY Pol(328-336) subtype-specific non-susceptible form
                       KQNPDIVIY Pol(328-336) B*18 human epitope
                       KQNPDIVIY Pol(328-336) B*35:02, B*35:03, B*53:01 human epitope
                       KQNPDIVIY Pol(328-336) C*12:02 human epitope
                       KQNPDIVIi Pol(328-336) diminished HLA binding or increased off-rate; non-susceptible form
                       KQNPDIVIv Pol(328-336) diminished HLA binding or increased off-rate; diminished response; non-susceptible form
                       KQNPDIVIc Pol(328-336) diminished HLA binding or increased off-rate; diminished response; non-susceptible form
                       KQNPDIVIY Pol(328-336) C*12:02 human epitope
                       KQNPDIVIY Pol(328-336) C*12:02 human epitope
                       KQNPDIVIY Pol(328-336) C*12:02 human epitope
                       KQNPDIVIC Pol(328-336) human epitope
                       KQNPDIVIy Pol(328-336) observed variant
                       KQNPDIVIY Pol(328-336) human epitope
                       KQNPDIVIc Pol(328-336) drug induced; observed variant
                       AQNPEIVIY Pol(328-336) human epitope
                       KQNPDIVIY Pol(328-336) human epitope
                       KQNPDIVIYQY Pol(328-338) A*24 human epitope
                       KQNPDIVIYQY Pol(328-338) A*30 human epitope
                       AQNPEIVIYQY Pol(328-338) A*30:02 human epitope
                       KQNPDIVIYQY Pol(328-338) B*15:01 human epitope
                       KQNPDIVIYQY Pol(328-338) B*15:03 human epitope
                       KQNPDIVIYQY Pol(328-338) B*35:02, B*35:03, B*53:01 human epitope
                       KQNPDIVIYQY Pol(328-338) human epitope
                        QNPDIVIYQ Pol(329-337) human epitope
                        KNPEIVIYQYMDDLYV Pol(329-344) human epitope
                        KNPEIVIYQYMDDLYV Pol(329-344) macaque epitope
                        KNPEIVIYQYMDDLYV Pol(329-344) human epitope
                        KNPEIVIYQYMDDLYV Pol(329-344) human epitope
                        QNPDIVIYQYMDDLYVGS Pol(329-346) human epitope
                         NPDIVIQYQ Pol(330-337) A30 human epitope
                         NPDIVIYQY Pol(330-338) A*36 human epitope
                         NPEIVIYQY Pol(330-338) B*18 human epitope
                         NPDIVIYQY Pol(330-338) B*18 human epitope
                         NPEIVIYQY Pol(330-338) B*18 human epitope
                         NPEIVIYQY Pol(330-338) B*18 human epitope
                         NPDIVIYQY Pol(330-338) B*27 human epitope
                         NPDWIYQY Pol(330-338) B*35 human epitope
                         HPDIVIYQY Pol(330-338) B*35 human epitope
                         NPEIVIYQY Pol(330-338) B*35 human epitope
                         HPDIVIYQY Pol(330-338) B*35 human epitope
                         NPDIVIYQY Pol(330-338) B*35 human epitope
                         HPDIVIYQY Pol(330-338) B*35 human epitope
                         NPDIVIYQY Pol(330-338) B*35 epitope
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPeIVIYQY Pol(330-338) diminished HLA binding or increased off-rate
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         hPDIVIYQY Pol(330-338) susceptible form
                         hPDIlIYQY Pol(330-338) susceptible form
                         NPDIiIYQY Pol(330-338) susceptible form
                         NPeIVIYQY Pol(330-338) susceptible form
                         NPDlVIYQY Pol(330-338) susceptible form
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPeIVIYQY Pol(330-338) diminished HLA binding or increased off-rate; susceptible form
                         NPDlVIYQY Pol(330-338) susceptible form
                         NPDIiIYQY Pol(330-338) diminished HLA binding or increased off-rate; susceptible form
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         hPDIVIYQY Pol(330-338) observed variant
                         NPeIVIYQY Pol(330-338) observed variant
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         nPDIVIYQY Pol(330-338) susceptible form
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         HPDIVIYQY Pol(330-338) B35 human, macaque epitope
                         HPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPDVILIQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B35 human epitope
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPEIVIYQY Pol(330-338) B*35:01 human epitope
                         HPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         HPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPEIVIYQY Pol(330-338) B*35:01 human epitope
                         NPEIVIiQY Pol(330-338) diminished response; susceptible form
                         NPEIVIvQY Pol(330-338) diminished response; susceptible form
                         NPEIVIcQY Pol(330-338) diminished response; susceptible form
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPDIVIiQY Pol(330-338) diminished HLA binding or increased off-rate; diminished response; non-susceptible form
                         NPDIVIvQY Pol(330-338) diminished HLA binding or increased off-rate; diminished response; non-susceptible form
                         NPDIVIcQY Pol(330-338) diminished HLA binding or increased off-rate; diminished response; non-susceptible form
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPDIVIYQY Pol(330-338) B*35:01 human epitope
                         NPxIVIYQY Pol(330-338) calculated escape; literature escape
                         NPEIVIYQY Pol(330-338) B*35:01, B*35:08 human epitope
                         NPEIVIYQY Pol(330-338) B*35:02, B*35:03, B*53:01 human epitope
                         HPDIVIYQY Pol(330-338) B*35:02, B*35:03, B*53:01 human epitope
                         NPDIVIYQY Pol(330-338) B*35:02, B*35:03, B*53:01 human epitope
                         NPEIVIYQY Pol(330-338) B*42:01 human epitope
                         NPEIVIYQY Pol(330-338) C*07 human epitope
                         HPDIVIYQY Pol(330-338) C*12 human epitope
                         NPDIVIYQY Pol(330-338) human epitope
                         NPDIVIYQY Pol(330-338) human epitope
                         NPDIVIYQYM Pol(330-339) B51 human epitope
                         NPDIVIYQYv Pol(330-339) drug induced; susceptible form
                         NPDIVICQYM Pol(330-339) human epitope
                         NPDIVIyQYM Pol(330-339) observed variant
                         NPDIVIYQYMDDLYVGSDLEIGQHR Pol(330-354) A11 human epitope
                          PEIVIYQYM Pol(331-339) B*18:01 human epitope
                          PEIVIYDYM Pol(331-339) B*18:01, E*01:01, E*01:03 human epitope
                           EIVIYQYMD Pol(332-340) B*18:01 human epitope
                           EIVIYQYMD Pol(332-340) B*18:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             VIYQYvDDL Pol(334-342) non-susceptible form
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             VIVQYMDDL Pol(334-342) A*02 human epitope
                             VIYQYNDDL Pol(334-342) A*02 human epitope
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             VIYQYMMDL Pol(334-342) A*02 human epitope
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             VIYQYMDDL Pol(334-342) A*02 human epitope
                             iIYQYMDDL Pol(334-342) observed variant
                             VIcQYMDDL Pol(334-342) observed variant
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human, macaque epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 mouse epitope
                             VIYQYMDDL Pol(334-342) A*02:01 mouse epitope
                             VIYQYMDDL Pol(334-342) A*02:01 mouse epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYvDDL Pol(334-342) drug induced; escape documented in this paper
                             tIYQYMDDL Pol(334-342) drug induced; susceptible form
                             iIYQYMDDL Pol(334-342) drug induced; susceptible form
                             eIYQYMDDL Pol(334-342) drug induced; escape documented in this paper
                             VIcQYMDDL Pol(334-342) drug induced; diminished response
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 humanized mouse epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             VIYQYMDDL Pol(334-342) A*02:01 human epitope
                             tIYQYMDDL Pol(334-342) drug induced; susceptible form
                             iIYQYMDDL Pol(334-342) drug induced; susceptible form
                             eIYQYMDDL Pol(334-342) drug induced; escape documented in this paper
                             VIYQYvDDL Pol(334-342) drug induced; escape documented in this paper
                             VIcQYMDDL Pol(334-342) drug induced; diminished response
                             VIYQYMDDL Pol(334-342) A*02:01, A2 human epitope
                             cIYQYMDDL Pol(334-342) observed variant
                             VIYQYMMDL Pol(334-342) A*02:02, A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 transgenic mouse epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 transgenic mouse epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIcQYMDDL Pol(334-342) drug induced; susceptible form
                             VIYQYvDDL Pol(334-342) drug induced; susceptible form
                             VIcQYvDDL Pol(334-342) drug induced; susceptible form
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYvDDL Pol(334-342) drug induced; susceptible form
                             VIYQYiDDL Pol(334-342) drug induced; susceptible form
                             iIYQYvDDL Pol(334-342) observed variant
                             VIYQYMMDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) A2 human epitope
                             VIYQYMDDL Pol(334-342) B*35:02, B*35:03, B*53:01 human epitope
                             VIYQYMDDL Pol(334-342) B*51 human epitope
                             VIYQYMDDLYV Pol(334-344) A*02:01 human epitope
                             VIYQYMDDLYV Pol(334-344) A*02:01 human epitope
                             VIYQYVDDLYV Pol(334-344) A*02:01 human epitope
                             VIYQYMDDLYV Pol(334-344) A*02:01 human epitope
                             VIYQYvDDLYV Pol(334-344) inferred escape
                             VIYQYMDDLYV Pol(334-344) A*02:01 human epitope
                             VIYQYMDDLYV Pol(334-344) A*02:01 human epitope
                             VIYQYMDDLYVGSDL Pol(334-348) human epitope
                             VIYQYMDDLYVGSDL Pol(334-348) human epitope
                              IYQYMDDL Pol(335-342) C*08:01 human epitope
                              IYQYMDDLYV Pol(335-344) A*02:01 human epitope
                              IYQYMDDLYV Pol(335-344) A*02:01 humanized mouse epitope
                              IYQYvDDLYV Pol(335-344) subtype-specific susceptible form
                              IYQYMDDLYi Pol(335-344) subtype-specific susceptible form
                              IYsYMDDLYV Pol(335-344) subtype-specific susceptible form
                              IcQYMDDLYV Pol(335-344) subtype-specific susceptible form
                              IYQYMDDLYV Pol(335-344) A*02:01 human epitope
                              IYQYMDDLYV Pol(335-344) A*02:01 human epitope
                              IcQYMDDLYV Pol(335-344) diminished response; non-susceptible form
                              IvQYMDDLYV Pol(335-344) diminished response; non-susceptible form
                              IiQYMDDLYV Pol(335-344) diminished response; non-susceptible form
                               YQYMDDLYV Pol(336-344) A*02 human epitope
                               YQYvDDLYV Pol(336-344) non-susceptible form; susceptible form
                               YQYMDDLYV Pol(336-344) A*02 human epitope
                               YQYVDDLYV Pol(336-344) A*02 human epitope
                               YQYmDDLYV Pol(336-344) observed variant
                               YQYMDDLYV Pol(336-344) A*02 human epitope
                               YQYvDDLYV Pol(336-344) drug induced; observed variant
                               YQYMDDLYV Pol(336-344) A*02 human epitope
                               YQYVDDLYV Pol(336-344) A*02:01 human epitope
                               YQYMDDLYV Pol(336-344) A*02:01 humanized mouse epitope
                               YQYvDDLYV Pol(336-344) subtype-specific susceptible form
                               YQYMDDLYi Pol(336-344) subtype-specific susceptible form
                               cQYMDDLYV Pol(336-344) subtype-specific susceptible form
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYvDDLYV Pol(336-344) drug induced; susceptible form
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYvDDLYV Pol(336-344) inferred escape
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                               YQYMDDLYV Pol(336-344) A*02:01 human epitope
                                QYMDDLYV Pol(337-344) A*02:01 human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health