HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

IRYQYNVLPQGWKGSPAI Pol(297-314) human epitope
 RYQYNVLPQGWKGSP Pol(298-312) human epitope
    YNVLPQGWKGSPAIF Pol(301-315) human epitope
       LPQGWKGSPA Pol(304-313) B*54:01 human epitope
       LPQGWKGSPA Pol(304-313) B*54:01 human epitope
       LPQGWKGSPA Pol(304-313) human epitope
       LPQGWKGSPs Pol(304-313) replicative capacity reduced
       LPQGWKGSPA Pol(304-313) human epitope
       LPQGWKGSPAI Pol(304-314) B*39:10 human epitope
       LPQGWKGSPAI Pol(304-314) B*42:01 human epitope
        PQGWKGSPAIFQSSM Pol(305-319) human epitope
        KQGWKGSPAIFQSSMT Pol(305-320) human epitope
        PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVG Pol(305-345) mouse epitope
         QGWKGSPAI Pol(306-314) B*51:01 human epitope
         QGWKGaPAI Pol(306-314) observed variant
         QGWKGSPAI Pol(306-314) human epitope
         QGWKGSPAIFQSSMTKIL Pol(306-323) C*12 human epitope
         QGWKGSPAIFQSSMTKIL Pol(306-323) human epitope
         QGWKGSPAIFQaSMTKIL Pol(306-323) susceptible form
         QGWKGSPAIFQSSMTKIL Pol(306-323) human epitope
           WKGSPAIFQSSMT Pol(308-320) B7 human epitope
           WKGSPAIFQSSMT Pol(308-320) B7 human epitope
           WKGSPAIFQSSMTKI Pol(308-322) human epitope
            KGSPAIFQSSM Pol(309-319) B*07 human epitope
            KGSPAIFQSSMTKIL Pol(309-323) human epitope
             GSPAIFQSS Pol(310-318) human epitope
             GSPAIFQSSMTKILE Pol(310-324) human epitope
             GSPAIFQSSMTKILE Pol(310-324) macaque epitope
             GSPAIFQSSMTKILE Pol(310-324) human epitope
             GSPAIFQSSMTKILE Pol(310-324) human epitope
             GSPAIFQSSMTKILE Pol(310-324) human epitope
              SPAIFQSSM Pol(311-319) A*30 human epitope
              SPAIFQSSM Pol(311-319) A*68:02 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQSSM Pol(311-319) B*07 human epitope
              SPAIFQCSM Pol(311-319) B*07:02 human epitope
              SPAIFQSSM Pol(311-319) B*07:02 human epitope
              SPAIFQSSM Pol(311-319) B*07:02 human epitope
              SPAIFQcSM Pol(311-319) diminished response; escape documented in this paper; non-susceptible form; susceptible form
              SPAIFQaSM Pol(311-319) diminished response; escape documented in this paper; non-susceptible form; susceptible form
              SPAIFQSSM Pol(311-319) B*07:02 human epitope
              SPAIFQSSM Pol(311-319) B*07:02 human epitope
              SPAIFQSSM Pol(311-319) B*07:02 human epitope
              SPAIFQSSM{TKILd} Pol(311-319) escape documented in this paper; processing
              SPAIFQSSM Pol(311-319) B*07:02 human epitope
              SPAIFQSSM Pol(311-319) B*07:02, B*35:01 human epitope
              SPAIFQSSM Pol(311-319) B*07:02, B*81:01 human epitope
              SPAIFQSSM Pol(311-319) B*15:17 human epitope
              SPAIFQSSM Pol(311-319) B*35 human epitope
              SPAIFQSSM Pol(311-319) B35 human epitope
              SPAIFQSSM Pol(311-319) B35 human epitope
              SPAIFQSSM Pol(311-319) B*35:01 human epitope
              SPAIFQSSM Pol(311-319) B*39 human epitope
              SPAIFQSSM Pol(311-319) B*42:01 human epitope
              SPAIFQSSM Pol(311-319) B*42:02 human epitope
              SPAIFQSSM Pol(311-319) B*42:02 human epitope
              SPAIFQSSM Pol(311-319) B*42:02 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) B7 human epitope
              SPAIFQSSM Pol(311-319) C*08 human epitope
              SPAIFQSSM Pol(311-319) human epitope
              SPAIFQSSM Pol(311-319) human epitope
              SPAIFQSSM Pol(311-319) human epitope
              SPAIFQSSM Pol(311-319) human epitope
              SPsIFQSSM Pol(311-319) susceptible form
              SPAIFQcSM Pol(311-319) susceptible form
              SPAIFQaSM Pol(311-319) susceptible form
              SPsIFQcSM Pol(311-319) non-susceptible form; susceptible form
              SPAIFaSSM Pol(311-319) non-susceptible form; susceptible form
              SPAaFQSSM Pol(311-319) non-susceptible form
              SPAIaQSSM Pol(311-319) non-susceptible form
              SPSIFQSSM Pol(311-319) human epitope
              SPAIFQSSM Pol(311-319) human epitope
              SPAIFQSSM Pol(311-319) human epitope
              SPAIFQSSM Pol(311-319) human epitope
              SPsIFQSSM Pol(311-319) replicative capacity reduced
              SPAIFQSSMT Pol(311-320) B*07 human, transgenic mouse epitope
              SPAIFQSSMT Pol(311-320) B*07 human epitope
              SPAIFQSSMT Pol(311-320) B*07 human epitope
              SPAIFQSSMT Pol(311-320) B35 human epitope
              SsPAIFQSSMT Pol(311-320) literature escape; non-susceptible form
              SPAIFQSSMT Pol(311-320) B7 human epitope
              SPAIFQSSMT Pol(311-320) B7 human epitope
              SPAIFQxSMT Pol(311-320) calculated escape
              SPAIFQSSMT Pol(311-320) B7 human epitope
              SPAIFQSSMT Pol(311-320) B7 human epitope
              SPAIFQSSMTK Pol(311-321) A*03, A*11, A*33, A*68:01, B*07, B*35 human epitope
              SPAIFQSSMTK Pol(311-321) A*11:01 human epitope
              SPAIFQSSMTK Pol(311-321) A*11:01 human epitope
              SPAIFQSSMTK Pol(311-321) B*07:02 human epitope
              SPAIFQSSMTK Pol(311-321) B*07:02 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03 human epitope
                AIFQSSMTK Pol(313-321) A*03, A*11 human epitope
                AIFQSSMTK Pol(313-321) A*03, A*11 human epitope
                AIFQSSMTK Pol(313-321) A*03, A*11 human epitope
                AIFQSSMTK Pol(313-321) A*03:01 human epitope
                AIFQCSMTK Pol(313-321) A*03:01 human epitope
                AIFQsSMTr Pol(313-321) diminished response; escape documented in this paper; non-susceptible form
                AIFQsSMTK Pol(313-321) non-susceptible form
                AIFQSSMTK Pol(313-321) A*03:01 human epitope
                AIFQSSMTK Pol(313-321) A*03:01 human epitope
                AIFQSSMTK Pol(313-321) A*03:01 human epitope
                AIFQSSMTK Pol(313-321) A*03:01 human epitope
                AIFQSSMTK Pol(313-321) A*03:01 human epitope
                AIFQSSMTK Pol(313-321) A*03:01, A*68:01, A11, A3, A33 human epitope
                AIFQSSMTK Pol(313-321) A*03:01, A11, A33 human epitope
                AIFQSSMTK Pol(313-321) A*03:01, A11, A33 human, macaque epitope
                AIFQSSMTK Pol(313-321) A*03:01, A*11:01, A*68:01, A3 human epitope
                AIFQcSMTK Pol(313-321) susceptible form
                AIFQSSMTt Pol(313-321) diminished HLA binding or increased off-rate; non-susceptible form
                AIFQrSMTr Pol(313-321) diminished HLA binding or increased off-rate; susceptible form
                AIlQSSMTr Pol(313-321) diminished response; susceptible form
                AIFQSSMTr Pol(313-321) susceptible form
                sIFQSSMTK Pol(313-321) susceptible form
                AIFQSSMTK Pol(313-321) A03 supertype human epitope
                AIFQSSMTK Pol(313-321) A*11 human epitope
                AIFQSSMTK Pol(313-321) A*11 human epitope
                AIFQSSMTK Pol(313-321) A*11 human epitope
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTr Pol(313-321) escape documented in this paper
                tIFQSSMTr Pol(313-321) observed variant
                AIFQSSMar Pol(313-321) observed variant
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTx Pol(313-321) calculated escape
                AIFQSSMTK Pol(313-321) A11 human epitope
                SIFQSSMTK Pol(313-321) A11 human epitope
                AIFQSSMTK Pol(313-321) A11, A3 human epitope
                AIFQSSMTK Pol(313-321) A11, A3 human epitope
                AIFQSSMTK Pol(313-321) A11, A3 human epitope
                AIFQSSMTK Pol(313-321) A11, A3, A33 human epitope
                SIFQSSMTK Pol(313-321) A11, A3, A33 human epitope
                AIFQSSMTK Pol(313-321) A11, A3, A33, A68 epitope
                AIFQSSMTK Pol(313-321) A*11:01 human epitope
                AIFQSSMTK Pol(313-321) A*11:01 human epitope
                AIFQSSMTK Pol(313-321) A*11:01 human epitope
                AIFQSSMTK Pol(313-321) A*11:01 human epitope
                AIFQSSMTK Pol(313-321) A*11:01 human epitope
                AIFQSSMTK Pol(313-321) A*11:01 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQaSMTK Pol(313-321) diminished response; subtype-specific susceptible form
                sIFQSSMTK Pol(313-321) subtype-specific susceptible form
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMlK Pol(313-321) non-susceptible form
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTr Pol(313-321) susceptible form
                AIFlSSMTK Pol(313-321) escape documented in this paper
                tIsQSSMTK Pol(313-321) escape documented in this paper
                AIlQSSMTK Pol(313-321) observed variant
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A3 human epitope
                AIFQSSMTK Pol(313-321) A33 human epitope
                AIFQSSMTK Pol(313-321) A33 human epitope
                AIFQSSMTK Pol(313-321) A3 supertype human, mouse epitope
                AIFQSSMTK Pol(313-321) A3 supertype human epitope
                AIFQSSMTK Pol(313-321) A*68:01 human epitope
                AIFQSSMTK Pol(313-321) human epitope
                AIFQSSMTK Pol(313-321) human epitope
                SIFQSSMTK Pol(313-321) human epitope
                AIFQCSMTK Pol(313-321) human epitope
                AIFQsSMTK Pol(313-321) observed variant
                AIFQSSMTK Pol(313-321) human epitope
                sIFQSSMTK Pol(313-321) replicative capacity reduced
                AIFQSSMTK Pol(313-321) human epitope
                AIFQSSMTK Pol(313-321) human epitope
                AIFQSSMTK Pol(313-321) human epitope
                AIFQSSMTK Pol(313-321) human epitope
                AIFQSSMTKILEPFR Pol(313-327) human epitope
                AIFQSSMTKILEPFRKQN Pol(313-330) human epitope
                AIFQSSMTKILEPFRKQNPDIVIYQ Pol(313-337) A11 human epitope
                AIFQSSMTKILEPFRKQNPDIVIYQ Pol(313-337) A11 human epitope
                 IFQSSMTKI Pol(314-322) H-2Kd mouse epitope
                 IFQaSMTKI Pol(314-322) susceptible form
                 IFQcSMTKI Pol(314-322) diminished response
                 IFQSSMTKI Pol(314-322) H-2Kd mouse epitope
                 IFQSSMTKI Pol(314-322) H-2Kd mouse epitope
                 IFgSSMTKa Pol(314-322) diminished HLA binding or increased off-rate
                 IFQSSMTKI Pol(314-322) H-2d human, mouse epitope
                 IFQSSMTKI Pol(314-322) H-2d mouse epitope
                 IFQSSMTKI Pol(314-322) mouse epitope
                 IFQSSMTKIL Pol(314-323) human epitope
                 IFQSSMTKILEPFRA Pol(314-328) macaque epitope
                 IFQSSMTKILEPFRA Pol(314-328) human epitope
                     SMTKILEPF Pol(318-326) human epitope
                     SMTKILEPFRAQNPE Pol(318-332) human epitope
                      MTKILEPFR Pol(319-327) A*03:01 human epitope
                      MTKILdPFR Pol(319-327) diminished HLA binding or increased off-rate; escape documented in this paper
                      MTKILEPFR Pol(319-327) A3 supertype human epitope
                      MTKILEPFR Pol(319-327) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health