HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

VGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGL Nef(66-97) human epitope
       QVPLRPMTYKAAFDLSFFLKEKG Nef(73-95) human epitope
           RPMTYKAAVDLSHFLK Nef(77-92) A*02:01 human epitope
            PMTYKAAVDLSHFLK Nef(78-92) A3 human epitope
            PMTYKGAFDLSHFLK Nef(78-92) B62 human epitope
            PMTYKAAVDLSHFLK Nef(78-92) B62 human epitope
             MTYKAALDLSHFLK Nef(79-92) human epitope
             MTYKGAFDLSHFLKE Nef(79-93) human epitope
              TYKAAVDLSHFLKEK Nef(80-94) human epitope
               YKAAVDLSHFLKEKG Nef(81-95) B57 human epitope
               FKAALDLSHFLNEKG Nef(81-95) human epitope
               FKAAvDLSHFLNEKG Nef(81-95) non-susceptible form
               YKAAVDLSHFLKEKG Nef(81-95) human epitope
               FKGAFDLSFFLKEKEGGL Nef(81-97) B*42:01 human epitope
               FKGAFDLSFFLKEKGGL Nef(81-97) C*04 human epitope
               YKGALDLSHFLKEKGGL Nef(81-97) human epitope
               fKGAfDLSfFLKEKGGL Nef(81-97) subtype-specific susceptible form
               YKAAVDLSHFLKEKGGL Nef(81-97) human epitope
               YKGALDLSHFLKEKGGLE Nef(81-98) human epitope
               YKGAVDLSHFLKEKGGLE Nef(81-98) human epitope
               YKaAVDLSHFLKEKGGLEGL Nef(81-98) observed variant
               YKaAVDLSHFLKEKGGLE Nef(81-98) observed variant
               YKAAVDLSHFLKEKGGLEGL Nef(81-100) human epitope
               YKgAVDLSHFLKEKGGLE Nef(81-100) observed variant
                KAAVDLSHFLK Nef(82-92) A*11:01 human epitope
                KGAFDLSFFLKEKGG Nef(82-96) human epitope
                KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
                KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
                 GAFDLSFFLK Nef(83-92) A*11 human epitope
                 AAVDLSHFLK Nef(83-92) A11 human epitope
                 GAFDLSFFLK Nef(83-92) A11 human epitope
                 AAVDLSHFLK Nef(83-92) A11 human epitope
                 vAlDLSHFLK Nef(83-92) susceptible form
                 AAVDLSHFLK Nef(83-92) A*11:01 human epitope
                 AAVDLSHFLKEK Nef(83-94) A11 human epitope
                 GALDLSHFLKEKGGL Nef(83-97) A3 human epitope
                  AVDLSHFLK Nef(84-92) A*03 human epitope
                  AVDLSHFLK Nef(84-92) A*03 human epitope
                  AmDLSHFLK Nef(84-92) observed variant
                  AVDLSHFLK Nef(84-92) A*03, A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*03, A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*03:01 human epitope
                  AVDLSHFLK Nef(84-92) A*03:01 human epitope
                  ALDLSHFLR Nef(84-92) A*03:01 human epitope
                  AvDLSHFLk Nef(84-92) non-susceptible form; susceptible form
                  ALDLSHFLk Nef(84-92) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                  AVDLSHFLK Nef(84-92) A*03:01 human epitope
                  AlDLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlDLSHFLr Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlDiSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlnLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlDmSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AVDLSHFLK Nef(84-92) A*03:01, A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human, macaque epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AfDLSHFLr Nef(84-92) diminished HLA binding or increased off-rate
                  ArDLSHFLK Nef(84-92) diminished HLA binding or increased off-rate
                  AlDLSHFLK Nef(84-92) susceptible form
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AlDLSHFLK Nef(84-92) observed variant
                  AfDLSHFLK Nef(84-92) diminished HLA binding or increased off-rate
                  AiDLSHFLK Nef(84-92) observed variant
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, Cw8 human epitope
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  ALDLSHFLK Nef(84-92) A*11:01 human epitope
                  ALDLSHFLr Nef(84-92) escape documented in this paper
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLr Nef(84-92) escape documented in this paper
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AfDLSfFLK Nef(84-92) diminished HLA binding or increased off-rate; subtype-specific non-susceptible form
                  ALDLSHFLK Nef(84-92) A*11:01 human epitope
                  AvDLSHFLK Nef(84-92) non-susceptible form
                  ALDLSHFLr Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  ALDiSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  ALnLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  ALDmSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AVDLSHFLK Nef(84-92) A3 human epitope
                  AVDLSHFLK Nef(84-92) A3 human epitope
                  AVDLSHFLK Nef(84-92) A3 human epitope
                  AVDLSHFLK Nef(84-92) B*15:03 human epitope
                  AVDLSHFLK Nef(84-92) B*15:17 human epitope
                  AVDLSHFLK Nef(84-92) C*08 human epitope
                  AVDLSHFLK Nef(84-92) human epitope
                  ALDLSHFLK Nef(84-92) human epitope
                  AvDLSHFLK Nef(84-92) observed variant
                  AVDLSHFLK Nef(84-92) human epitope
                  AVnLSHFLK Nef(84-92) susceptible form
                  AFDLSFFLK Nef(84-92) human epitope
                  AVDLSHFLK Nef(84-92) human epitope
                  AlDLSHFLK Nef(84-92) subtype-specific susceptible form
                  AfDLSfFLK Nef(84-92) subtype-specific susceptible form
                  AVDLSHFLK Nef(84-92) human epitope
                  AlDLSHFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLgHFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLaHFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLSfFLK Nef(84-92) non-susceptible form
                  AVDLSaFLK Nef(84-92) non-susceptible form
                  AVDaSHFLK Nef(84-92) non-susceptible form; susceptible form
                  AfDLSfFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLSHFLK Nef(84-92) human epitope
                  ALDLSHFLK Nef(84-92) human epitope
                  AVNLSHFLK Nef(84-92) human epitope
                  AVdLSHFLK Nef(84-92) susceptible form
                   VDLSHFLK Nef(85-92) A*11:01 human epitope
                   VDLSHFLKEKGGLEGL Nef(85-100) A*02:01 human epitope
                    DLSHFLK Nef(86-92) A*11:01 human epitope
                    DLSHFLKEK Nef(86-94) A*03, A*11 human epitope
                    DLSfFLKEK Nef(86-94) observed variant
                    DLSfFLiEK Nef(86-94) observed variant
                    DLSfFLrEK Nef(86-94) observed variant
                    DLSfFLKEq Nef(86-94) observed variant
                    DLSfFLrEq Nef(86-94) observed variant
                    DLSHFLKEK Nef(86-94) A*03:01 human epitope
                    DLSHFLKEK Nef(86-94) A*03:01 human, macaque epitope
                    DLSHFLKEK Nef(86-94) A*03:01 human epitope
                    DLSHFLKEK Nef(86-94) A*03:01, A11 human epitope
                    DLSFLKEK Nef(86-94) A11, A3 human epitope
                    DLSHFLKEK Nef(86-94) A3 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) A2 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) B35 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) B35, Cw4 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) human epitope
                     LSHFLKEKGGLEG Nef(87-99) human epitope
                     FSHFLKEKGGLEGLIY Nef(87-102) human epitope
                     lSHFLKEKGGLdGLIY Nef(87-102) observed variant
                     lSHFLKEKGGLEGLIY Nef(87-102) observed variant
                     lSHFLKEKGGLEGLIw Nef(87-102) observed variant
                     lSfFLKEKGGLEGLIY Nef(87-102) observed variant
                      SHFLKEKGGLEGL Nef(88-100) human epitope
                      SfFLKEKGGLEGL Nef(88-100) observed variant
                      SFFLKEKGGLEGLIYSKK Nef(88-105) C*05 human epitope
                      SFFLKEKGGLEGLIYSKK Nef(88-105) human epitope
                      SHFLKEKGGLEGLIYSQK Nef(88-105) human epitope
                      SfFLKEKGGLEGLIYSkK Nef(88-105) subtype-specific susceptible form
                      SHFLKEKGGLEGLIYSQK Nef(88-105) human epitope
                       HFLKEKGGL Nef(89-97) human epitope
                       FFLKEKGGLEGLIYS Nef(89-103) human epitope
                       HFLKEKGGLEGLIYSQKR Nef(89-106) human epitope
                       FFLKEKGGLEGLIHSQKR Nef(89-106) human epitope
                        FLKEKGGL Nef(90-97) A*02:01 human epitope
                        FLKEKGGL Nef(90-97) A2, B8 human epitope
                        FLKEqGGL Nef(90-97) observed variant
                        FLKEKGGL Nef(90-97) A3 human epitope
                        FLKEKGGL Nef(90-97) B*07 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEqGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEeGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKdKGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        sLKEKGGL Nef(90-97) susceptible form
                        lLKEKGGL Nef(90-97) susceptible form
                        FiKEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLeEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKgnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        -------- Nef(90-97) epitope loss
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLrEKGGL Nef(90-97) diminished response
                        FLrdKGGL Nef(90-97) escape documented in this paper
                        FLKErGGL Nef(90-97) diminished response
                        FLrkeGGL Nef(90-97) observed variant
                        FLKEqGGL Nef(90-97) diminished response; susceptible form
                        FLKEmGGL Nef(90-97) diminished response
                        FLKEnGGL Nef(90-97) diminished response
                        FLKEtGGL Nef(90-97) diminished response
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEnGGL Nef(90-97) literature escape; processing
                        FLKEmGGL Nef(90-97) literature escape; processing
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLrEKGGL Nef(90-97) literature escape
                        FLKdKGGL Nef(90-97) literature escape
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEqGGL Nef(90-97) non-susceptible form; susceptible form
                        FLKEtGGL Nef(90-97) non-susceptible form; susceptible form
                        FLKEnGGL Nef(90-97) diminished response; non-susceptible form
                        FLKEmGGL Nef(90-97) diminished response; non-susceptible form; susceptible form
                        FLKEeGGL Nef(90-97) diminished response; non-susceptible form
                        FLrEKGGL Nef(90-97) diminished response; non-susceptible form
                        FLKdKGGL Nef(90-97) non-susceptible form; susceptible form
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEtGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEnGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEmGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEqGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLrEKGGL Nef(90-97) literature escape
                        FLKEeGGL Nef(90-97) literature escape
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEqGGL Nef(90-97) escape documented in this paper; literature escape; non-susceptible form
                        FLKEeGGL Nef(90-97) escape documented in this paper; literature escape; non-susceptible form
                        FLKEnGGL Nef(90-97) escape documented in this paper; literature escape; non-susceptible form; susceptible form
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEqGGL Nef(90-97) escape documented in this paper
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*35:01, B*35:08 human epitope
                        FLKEKGGL Nef(90-97) B*40 human epitope
                        FLKEKGGL Nef(90-97) B*57 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL? Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEeGGL Nef(90-97) escape documented in this paper
                        FLKEgGGL Nef(90-97) observed variant
                        FLKgeGGL Nef(90-97) observed variant
                        FLKveGGL Nef(90-97) observed variant
                        cLKEKGGL Nef(90-97) observed variant
                        sLKEKGGL Nef(90-97) observed variant
                        FLKEeGGL{p} Nef(90-97) observed variant
                        FLKEKGGL Nef(90-97) B8 epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 epitope
                        FLKEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEeGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEqGGL Nef(90-97) susceptible form
                        FLKdKGGL Nef(90-97) diminished response
                        FLeEnGGL Nef(90-97) non-susceptible form
                        FLKgnGGL Nef(90-97) non-susceptible form
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human, macaque epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEnGGL Nef(90-97) inferred escape
                        FLKEKGGL Nef(90-97) B8 human epitope
                        SLKEKGGL Nef(90-97) B8 human epitope
                        LLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEMGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKErGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEmGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEtGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEeGGL Nef(90-97) HLA association; TCR related mutation
                        FLrEKGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEKGGLEGL Nef(90-100) A2 human epitope
                        FLKEKGGLEGLIYSK Nef(90-104) human epitope
                        FLKEKGGLEGLIYSK Nef(90-104) human epitope
                        FLKEKGGLEGLIHSQ Nef(90-104) human epitope
                        FLKEKGGLEGLIYSK Nef(90-104) human epitope
                         LKEKGGLEGLIYSQKRQDIL Nef(91-110) human epitope
                          KEKGGLEGL Nef(92-100) B*35:02, B*35:03, B*53:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLDGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLdGL Nef(92-100) subtype-specific non-susceptible form; subtype-specific susceptible form
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLdGL Nef(92-100) diminished response
                          KEKGGLEeL Nef(92-100) inferred escape
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGm Nef(92-100) inferred escape
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:02 human epitope
                          KEKGGLEGL Nef(92-100) B*40:02 human epitope
                          KEKGGLEGL Nef(92-100) B*44:03 human epitope
                          KEKGGLEGL Nef(92-100) B*44:03 human epitope
                          KEKGGLEGL Nef(92-100) B*55 human epitope
                          KEKGGLEGL Nef(92-100) B*60, B*61 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGi Nef(92-100) escape documented in this paper
                          KkKGGLEGL Nef(92-100) escape documented in this paper
                          KEKGGLEGp Nef(92-100) escape documented in this paper
                          KEKGGLEeL Nef(92-100) escape documented in this paper
                          KEKGGLErL Nef(92-100) escape documented in this paper
                          KEKrGLErL Nef(92-100) escape documented in this paper
                          KEnGGLEGL Nef(92-100) escape documented in this paper
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KgKGGLEGL Nef(92-100) escape documented in this paper
                          KkKGGLEGL Nef(92-100) escape documented in this paper
                          KEnGGLErL Nef(92-100) inferred escape
                          KEKrGLErL Nef(92-100) inferred escape
                          KEKGGLkGL Nef(92-100) inferred escape
                          KEKGGLdGL Nef(92-100) inferred escape
                          KEKGGLErL Nef(92-100) inferred escape
                          KEKGGLEeL Nef(92-100) inferred escape
                          KEKGGLEGp Nef(92-100) inferred escape
                          KEKGGLEGi Nef(92-100) inferred escape
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) human epitope
                          KEKGGLEGi Nef(92-100) HLA association; susceptible form
                          KEKGGLEGLIY Nef(92-102) B*44:03 human epitope
                          KEKGGLEGLIY Nef(92-102) B*44:03 human epitope
                          KEKGGLEGLIY Nef(92-102) B*44:03 human epitope
                          KEKGGLEGLVYSQK Nef(92-105) human epitope
                          KEKGGLEGLIHSQRRQDILDL Nef(92-112) human epitope
                          KEKGGLEGLIHSQRRQDILDL Nef(92-112) human epitope
                          KEKGGLEGLIHSQRRQDILDL Nef(92-112) human epitope
                           EKGGLEGLIHSQRR Nef(93-106) A1, B8 human epitope
                              GLEGLIYSQKRQDILDLW Nef(96-113) human epitope
                              GLEGLIYSkKRQeILDLW Nef(96-113) subtype-specific susceptible form
                               LEGLIYSKKRQEILD Nef(97-111) human epitope
                               LEGLIYSQKRQDILD Nef(97-111) human epitope
                               LEGLIYSQKRQDILDLWV Nef(97-114) human epitope
                                  LIYSKKRQEILDLWV Nef(100-114) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health