HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

VGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGL Nef(66-97) human epitope
  FPVRPQVPLRPMTYKGA Nef(68-84) human epitope
  FPVRPQVPLRPMTYKaA Nef(68-84) observed variant
    VTPQVPLRPMTYKAA Nef(70-84) human epitope
     KPQVPLRPMTYKAAV Nef(71-85) A3, B35 human epitope
     RPQVPLRPMTYKAAL Nef(71-85) human epitope
     RPQVPLRPMTYKAAL Nef(71-85) human epitope
     RPQVPLRPMTYKAAL Nef(71-85) human epitope
     RPQVPLRPMTYKAAVDLSHF Nef(71-90) human epitope
      PQVPLRPMTYKGAFD Nef(72-86) human epitope
      PQVPLRPMTYKAAVDLSHFL Nef(72-91) human epitope
      PQVPLRRMTYKAAVDLSHFL Nef(72-91) human epitope
      PQVPLRMTYKAAVDLSHFL Nef(72-91) human epitope
       QVPLRPMTYKAAVDL Nef(73-87) B57 human epitope
       QVPLRPMTYKAAVDL Nef(73-87) human epitope
       QVPLRPMTfKAAVDL Nef(73-87) observed variant
       QVPLRPMTYKAAVDL Nef(73-87) human epitope
       AVPLRPMTYKAAFDLSFF Nef(73-90) A*68:02 human epitope
       QVPLRPMTYKGALDLSHF Nef(73-90) human epitope
       QVPLRPMTYKAAVDLSHF Nef(73-90) human epitope
       QVPLRPMTYKAAFDLSFFLKEKG Nef(73-95) human epitope
        VPLRPMTYRAARDLS Nef(74-88) B7 supertype human epitope
        IPLRPMTYKGALDLS Nef(74-88) B7 supertype human epitope
         PLRPMTYKAALDLSH Nef(75-89) human epitope
          LRPMTYKAA Nef(76-84) B*27:03 human epitope
          LRPMTYKAA Nef(76-84) B*27:03 human epitope
           RPMTYKAAL Nef(77-85) A*32 human epitope
           RPMTYKAAL Nef(77-85) B*07 human, transgenic mouse epitope
           RPMTYKgAL Nef(77-85) susceptible form
           RPMTYKAAv Nef(77-85) susceptible form
           RPMTfKAAL Nef(77-85) susceptible form
           RPMTYKfAL Nef(77-85) susceptible form
           RPMTYKAAf Nef(77-85) susceptible form
           RPMTYKGAL Nef(77-85) B*07 human epitope
           RPMTYKAAL Nef(77-85) B*07 human epitope
           RPMTYKAAL Nef(77-85) B*07 human epitope
           RPMTYKAAV Nef(77-85) B*07 human epitope
           RPMTYKAAL Nef(77-85) B*07 human epitope
           RPMTYKAAV Nef(77-85) B*07 human epitope
           RPMTYKAAL Nef(77-85) B*07 human epitope
           RPMTYKAAL Nef(77-85) B*07 human epitope
           RPMThqAAw Nef(77-85) diminished response; susceptible form
           RPMTYKGAL Nef(77-85) B*07:02 human epitope
           RPMTYKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
           RPMTYKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
           RPMTYKaAf Nef(77-85) diminished response; escape documented in this paper; susceptible form
           RPMTYKaAi Nef(77-85) diminished response; escape documented in this paper; susceptible form
           RPMTfKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTfKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTYKgAv Nef(77-85) diminished response; escape documented in this paper; susceptible form
           RPMTFKGAL Nef(77-85) B*07:02 human epitope
           RPMTFKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTFKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTyKaAi Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTyKaAf Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTyKGAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTyKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTyKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
           RPMTyKGAL Nef(77-85) susceptible form
           RPMTYKAAL Nef(77-85) B*07:02 human epitope
           RPMTYKAAV Nef(77-85) B*07:02 human epitope
           RPMTYKAAf Nef(77-85) subtype-specific susceptible form
           RPMTYKAAL Nef(77-85) B*07:02 human epitope
           RPMTYKAAL Nef(77-85) B*07:02 human epitope
           RPMTYKGAL Nef(77-85) B*07:02 human epitope
           RPMTfKGAL Nef(77-85) inferred escape; literature escape
           RPMTFKGAL Nef(77-85) B*07:02 human epitope
           RPMTYKAAL Nef(77-85) B*18 human epitope
           RPMTYKAAV Nef(77-85) B*42:01 human epitope
           RPMTFKGAF Nef(77-85) B*42:01, B*42:02 human epitope
           RPMTYKAAL Nef(77-85) B7 human epitope
           RPMTYKAAL Nef(77-85) B7 human epitope
           RPMTYKAAV Nef(77-85) B7 human epitope
           RPMTYKAAl Nef(77-85) observed variant
           RPMTYKgAi Nef(77-85) non-susceptible form; susceptible form
           RPMTYKgAl Nef(77-85) observed variant
           RPMTYKgAf Nef(77-85) observed variant
           RPMTfKgAf Nef(77-85) observed variant
           RPMTfKAAV Nef(77-85) observed variant
           RPMTYKeAV Nef(77-85) observed variant
           RPMTYKGAL Nef(77-85) B7 human epitope
           RPMTYKAAV Nef(77-85) B7 human epitope
           RPMTYKGAL Nef(77-85) B7 human epitope
           RPMTYrGAL Nef(77-85) observed variant
           RPMTYKaAL Nef(77-85) observed variant
           RPMTYKGAv Nef(77-85) observed variant
           RPMsYKaAL Nef(77-85) observed variant
           RPMTfKGAL Nef(77-85) observed variant
           RPMTYKAAL Nef(77-85) B7 human epitope
           RPMTYKAAV Nef(77-85) B7 human epitope
           RPMTYKAAL Nef(77-85) B7 human epitope
           RPMTYKAAV Nef(77-85) B7 human epitope
           RPMTYKAAV Nef(77-85) B7 human epitope
           RPMTYKGAL Nef(77-85) B7 human epitope
           RPMTYKaAv Nef(77-85) observed variant
           RPMTYKaAL Nef(77-85) observed variant
           RPMTYKAAL Nef(77-85) B7 human epitope
           RPMTYKAAV Nef(77-85) B7 human epitope
           RPMTYKAAL Nef(77-85) B7 human epitope
           RPMTYKGAL Nef(77-85) B7 supertype human epitope
           RPMTYraAr Nef(77-85) susceptible form
           RPMTYKAAL Nef(77-85) B*81 human epitope
           RPMTYKAAV Nef(77-85) B*82 human epitope
           RPMTYKAAL Nef(77-85) B*82 human epitope
           RPMTYKAAV Nef(77-85) C*08 human epitope
           RPMTYKAAL Nef(77-85) C*17 human epitope
           RPMTYKAAV Nef(77-85) human epitope
           RPMTYKGAL Nef(77-85) human epitope
           RPMTYKAAV Nef(77-85) human epitope
           RPMTWKGAL Nef(77-85) human epitope
           RPMTWKAAL Nef(77-85) susceptible form
           RPMTYKGAL Nef(77-85) susceptible form
           RPMTRKAAL Nef(77-85) susceptible form
           RPMTCKGAL Nef(77-85) susceptible form
           RPMTYKAAL Nef(77-85) observed variant
           RPITYKAAL Nef(77-85) susceptible form
           RPMTYKAAV Nef(77-85) human epitope
           RPMTYKAALDLSHFL Nef(77-91) B62 human epitope
           RPMTYKGAVDLSHFL Nef(77-91) B62 human epitope
           RPMTYKGAFDLSFFL Nef(77-91) human epitope
           RPMTYKAAVDLSHFL Nef(77-91) human epitope
           RPMTfKAAVDLSHFL Nef(77-91) observed variant
           RPMTYKAAVDLSHFLK Nef(77-92) A*02:01 human epitope
            PMTYKAAVDLSHFLK Nef(78-92) A3 human epitope
            PMTYKGAFDLSHFLK Nef(78-92) B62 human epitope
            PMTYKAAVDLSHFLK Nef(78-92) B62 human epitope
             MTYKAAFDL Nef(79-87) A*02:01 human epitope
             MTYKAALDL Nef(79-87) A*02:01 mouse epitope
             MTYKAALDL Nef(79-87) A2 human, humanized mouse epitope
             MTYKAAVDL Nef(79-87) B63 human epitope
             MTYKGALDL Nef(79-87) human epitope
             MTYKAALDLSHFLK Nef(79-92) human epitope
             MTYKGAFDLSHFLKE Nef(79-93) human epitope
              TYKAAVDL Nef(80-87) A24 human epitope
              TYKAAVDL Nef(80-87) A24 human epitope
              TYKgAfDL Nef(80-87) observed variant
              TfKAAVDL Nef(80-87) observed variant
              TfKgAfDL Nef(80-87) observed variant
              TYKeAVDL Nef(80-87) observed variant
              TYKgAiDL Nef(80-87) observed variant
              TYKgAlDL Nef(80-87) observed variant
              TYKAAlDL Nef(80-87) observed variant
              TYKAAVDLSHFLKEK Nef(80-94) human epitope
               YKGALDLSHFL Nef(81-91) human epitope
               YKAAVDLSHFLKEKG Nef(81-95) B57 human epitope
               FKAALDLSHFLNEKG Nef(81-95) human epitope
               FKAAvDLSHFLNEKG Nef(81-95) non-susceptible form
               YKAAVDLSHFLKEKG Nef(81-95) human epitope
               FKGAFDLSFFLKEKEGGL Nef(81-97) B*42:01 human epitope
               FKGAFDLSFFLKEKGGL Nef(81-97) C*04 human epitope
               YKAAVDLSHFLKEKGGL Nef(81-97) human epitope
               YKGALDLSHFLKEKGGL Nef(81-97) human epitope
               fKGAfDLSfFLKEKGGL Nef(81-97) subtype-specific susceptible form
               YKGAVDLSHFLKEKGGLE Nef(81-98) human epitope
               YKaAVDLSHFLKEKGGLEGL Nef(81-98) observed variant
               YKaAVDLSHFLKEKGGLE Nef(81-98) observed variant
               YKGALDLSHFLKEKGGLE Nef(81-98) human epitope
               YKAAVDLSHFLKEKGGLEGL Nef(81-100) human epitope
               YKgAVDLSHFLKEKGGLE Nef(81-100) observed variant
                KAAVDLSHF Nef(82-90) B*57 human epitope
                KgAVDLSHF Nef(82-90) observed variant
                KAAlDLSHF Nef(82-90) observed variant
                KrAlDLSHF Nef(82-90) observed variant
                KgAlDLSHF Nef(82-90) observed variant
                agAlnLSHF Nef(82-90) observed variant
                rgAVDLSHF Nef(82-90) observed variant
                KAAVDLSHF Nef(82-90) B*57 human epitope
                KAAVDiSHF Nef(82-90) observed variant
                KAAVnLSHF Nef(82-90) observed variant
                KgAlDLSHF Nef(82-90) observed variant
                KGAFDLSFF Nef(82-90) B*57 human epitope
                KAAVDLSHF Nef(82-90) B*57 human epitope
                KAAVDLSHF Nef(82-90) B*57, B*58:01 human epitope
                KgAVDLSHF Nef(82-90) diminished HLA binding or increased off-rate; escape documented in this paper; susceptible form
                KAAFDLSFF Nef(82-90) B*57, B*58:01 human epitope
                KgAFDLSFF Nef(82-90) HLA association; diminished HLA binding or increased off-rate; diminished response; escape documented in this paper
                KgAFgLSFF Nef(82-90) HLA association; observed variant
                KAAFgLSFF Nef(82-90) observed variant
                KgAvDLSFF Nef(82-90) observed variant; susceptible form
                KAAFDLSFF Nef(82-90) B*57, B*58:01 human epitope
                KAAVDLSHF Nef(82-90) B57 human epitope
                KAAFDLSFF Nef(82-90) B57 human epitope
                KAAFDLSFF Nef(82-90) B57 human epitope
                KAAFDLgFF Nef(82-90) diminished response
                KgAFDLgFF Nef(82-90) susceptible form
                KAALDLSHF Nef(82-90) B57 human epitope
                KSALDLSHF Nef(82-90) B57 human epitope
                KAAVDLSHF Nef(82-90) B57 human epitope
                KAAFDLSFF Nef(82-90) B*58:01, B57 human epitope
                KGALDLSHF Nef(82-90) B*58:01, B57 human epitope
                KAAFDLSFF Nef(82-90) B*57:01 human epitope
                KAALDLSHF Nef(82-90) B*57:01 human epitope
                KgALDLSHF Nef(82-90) diminished response
                qAALDLSHF Nef(82-90) diminished response
                tAALDLSHF Nef(82-90) observed variant
                pAALDLSHF Nef(82-90) observed variant
                KAAhDLSHF Nef(82-90) observed variant
                KAALDiSHF Nef(82-90) observed variant
                {l*****}qAALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                {*****}KgALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                {**}KAALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                KAAFDLSFF Nef(82-90) B*57:01, B*58:01 human epitope
                KAAFDLSFF Nef(82-90) B*57:02, B*57:03, B*58:01 human epitope
                KAAFDLSFF Nef(82-90) B*57:02, B*57:03, B*58:01 human epitope
                KgAFDLSFF Nef(82-90) escape documented in this paper
                KAAFDLSFF Nef(82-90) B*57:03 human epitope
                KAAFDLSFF Nef(82-90) B*58:01 human epitope
                KAAIDLSHF Nef(82-90) B*58:01 humanized mouse epitope
                KAAmDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                KAAlDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                KAAvDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                KAAIDiSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                KAAIDLSlF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                KAAFDLSFF Nef(82-90) B*58:01 human epitope
                KAAFDLgFF Nef(82-90) escape documented in this paper
                KAAFDLSFF Nef(82-90) B*58:01 human epitope
                KAAFDLgFF Nef(82-90) altered HLA expression; observed variant; replicative capacity reduced
                KAAFDLSFF Nef(82-90) B*58:01 human epitope
                KAAVDLSHF Nef(82-90) B*58:01 human epitope
                KAAFDLSFF Nef(82-90) B*58:01 human epitope
                KAAFDLSFF Nef(82-90) B*58:01 human epitope
                KeAFDLSFF Nef(82-90) escape documented in this paper
                {f}KAAFDLgFF Nef(82-90) escape documented in this paper
                KgAFDLSFF Nef(82-90) escape documented in this paper
                KgAvDLSFF Nef(82-90) escape documented in this paper
                rAAFDLSFF Nef(82-90) escape documented in this paper
                KAAvDLSFF Nef(82-90) escape documented in this paper
                {f}KAAFDLSFF Nef(82-90) escape documented in this paper
                -----LSFF Nef(82-90) escape documented in this paper
                KGALDLSHF Nef(82-90) C*12:02 human epitope
                KaAvDLSHF Nef(82-90) observed variant
                KAAVDLSHF Nef(82-90) C*12:02 human epitope
                KgAlDLSHF Nef(82-90) non-susceptible form
                KAAVDLSFF Nef(82-90) human epitope
                KAAVDLSFF Nef(82-90) human epitope
                KAAFDLSFF Nef(82-90) human epitope
                KAALDLSHF Nef(82-90) human epitope
                KAAVDLSHFL Nef(82-91) A*11 human epitope
                KAALDLSHFL Nef(82-91) A2 human epitope
                KAAvDLSHFL Nef(82-91) susceptible form
                KAAVDLSHFL Nef(82-91) B*57 human epitope
                KAALDLSHFL Nef(82-91) B*57:01 human epitope
                KAALDLSHlL Nef(82-91) observed variant
                rAALDLSHFL Nef(82-91) observed variant
                rAALDLSHlL Nef(82-91) observed variant
                rAAvDLSHFL Nef(82-91) observed variant
                KgALDLSHFL Nef(82-91) observed variant
                KAAvDLSHFL Nef(82-91) observed variant
                KAAFDLSFFL Nef(82-91) B*57:02, B*57:03, B*58:01 human epitope
                KgAFDLSFFL Nef(82-91) HLA association
                KAAVDLSHFL Nef(82-91) C*03 human epitope
                KAAVDLSHFL Nef(82-91) C*08 human epitope
                KAAlDLSHFL Nef(82-91) susceptible form
                KAAlDiSHFL Nef(82-91) susceptible form
                KgAVDLSHFL Nef(82-91) susceptible form
                KgAlDLSHFL Nef(82-91) susceptible form
                KAAVDLSHFL Nef(82-91) C*08 human epitope
                KAAVDLSHFL Nef(82-91) C*08:02 human epitope
                KAAFDLSFFL Nef(82-91) C*08:04 human epitope
                KAAVDLSHFL Nef(82-91) Cw8 human epitope
                KAAVDLSMFL Nef(82-91) Cw8 human epitope
                KAAVDLSHFL Nef(82-91) Cw8 human epitope
                KAAVDLSHFL Nef(82-91) Cw8 human epitope
                KAAVDLSHFL Nef(82-91) Cw8 human epitope
                KAAVDLSHFL Nef(82-91) Cw8 human epitope
                KAAVDLSHFL Nef(82-91) Cw8 human epitope
                KAAVDLSHFL Nef(82-91) Cw8 human epitope
                KAAVDLSHFLK Nef(82-92) A*11:01 human epitope
                KGAFDLSFFLKEKGG Nef(82-96) human epitope
                KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
                KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
                 AAVDLSHF Nef(83-90) B*62 human epitope
                 gAfDLSfF Nef(83-90) observed variant
                 gvfDLSfF Nef(83-90) observed variant
                 ggfDLSfF Nef(83-90) observed variant
                 AAfDLSfF Nef(83-90) observed variant
                 AAVDLSHFL Nef(83-91) A*02 human epitope
                 AAVDLSHFL Nef(83-91) A*02 human epitope
                 AAVDiSHFL Nef(83-91) diminished response
                 AAVDirHFL Nef(83-91) inferred escape
                 gAlDLSHFL Nef(83-91) diminished response; escape documented in this paper
                 gArDLSHFL Nef(83-91) escape documented in this paper
                 gAfDLSfFL Nef(83-91) escape documented in this paper
                 AAlDLSHFL Nef(83-91) escape documented in this paper
                 AAiDLSHFL Nef(83-91) escape documented in this paper
                 AAlDiSHFL Nef(83-91) diminished response
                 AAlDiSHlL Nef(83-91) inferred escape
                 kAlDLSHFL Nef(83-91) inferred escape
                 gAVDLSHFL Nef(83-91) escape documented in this paper
                 AAVDLSHFL Nef(83-91) A*02 human epitope
                 AAVDLSHFL Nef(83-91) A*02 human epitope
                 AAVDLSHFL Nef(83-91) A*02 human epitope
                 gAfDLSfFL Nef(83-91) observed variant
                 gvfDLSfFL Nef(83-91) observed variant
                 ggfDLSfFL Nef(83-91) observed variant
                 AAfDLSfFL Nef(83-91) observed variant
                 AAVDLSHFL Nef(83-91) A*02 human epitope
                 AAVDmSHFL Nef(83-91) diminished response; literature escape
                 gAlDLSHFL Nef(83-91) observed variant
                 AALDLSHFL Nef(83-91) A*02:01 mouse epitope
                 GAFDLSFFL Nef(83-91) A*02:05 human epitope
                 GAFDLSFFL Nef(83-91) A*02:05 human epitope
                 GAFDLSFFL? Nef(83-91) A*02:05 human epitope
                 GAFDLSFFL Nef(83-91) A*02:05 human epitope
                 GAFDLSFFL Nef(83-91) A*02:05 human epitope
                 GALDLSHFL Nef(83-91) A*02:06 human epitope
                 GAfDLSfFL Nef(83-91) subtype-specific susceptible form
                 aAvDLSHFL Nef(83-91) observed variant; subtype-specific susceptible form
                 GAFDLSFFL Nef(83-91) A*02:06 human epitope
                 GalDLShFL Nef(83-91) subtype-specific susceptible form
                 GAFDLSFFL Nef(83-91) A*03 human epitope
                 AAVDLSHFL Nef(83-91) A2 human epitope
                 AAVDLSHFL Nef(83-91) A2 human epitope
                 GALDLSHFL Nef(83-91) A2 human epitope
                 aAvDLSHFL Nef(83-91) susceptible form; subtype-specific susceptible form
                 AAVDLSHFL Nef(83-91) A2 human epitope
                 AALDLSHFL Nef(83-91) A2 human, humanized mouse epitope
                 AAVDLSHFL Nef(83-91) A2 human epitope
                 gAfDLSHFL Nef(83-91) observed variant
                 eAVDLSHFL Nef(83-91) observed variant
                 gAiDLSHFL Nef(83-91) observed variant
                 gAlDLSHFL Nef(83-91) observed variant
                 AAlDLSHFL Nef(83-91) observed variant
                 AAVDLSHFL Nef(83-91) A68 human epitope
                 AAVDLSHFL Nef(83-91) B*07 human epitope
                 AAVDLSHFL Nef(83-91) B*14 human epitope
                 AAVDLSHFL Nef(83-91) B*14 human epitope
                 GAFDLSFFL Nef(83-91) B*15:17 human epitope
                 AAVDLSHFL Nef(83-91) B*35:02, B*35:03, B*53:01 human epitope
                 GAFDLSFFL Nef(83-91) B*42:02 human epitope
                 AAFDLSFFL Nef(83-91) B*57:03 human epitope
                 AAFDLSFFL Nef(83-91) B*57:03 human epitope
                 AAVDLSHFL Nef(83-91) B*58 human epitope
                 AAVDLSHFL Nef(83-91) B*58 human epitope
                 AAVDLSHFL Nef(83-91) B*58:01 human epitope
                 AAVDLSHFL Nef(83-91) B60, B62, C*08:02, Cw8 human epitope
                 AAVDLSHFL Nef(83-91) B62, Cw8 human epitope
                 gAVDLSHFL Nef(83-91) susceptible form
                 AAiDLSHFL Nef(83-91) susceptible form
                 AAlDLSHFL Nef(83-91) diminished response; susceptible form
                 gAlDLSHFL Nef(83-91) diminished response
                 gAfDLSHFL Nef(83-91) diminished response; non-susceptible form
                 AAVDLSHFL Nef(83-91) B*81 human epitope
                 AAVDLSHFL Nef(83-91) C*03 human epitope
                 AALDLSHFL Nef(83-91) C*03 human epitope
                 AAVDLSHFL Nef(83-91) C*03 human epitope
                 GAFDLSFFL Nef(83-91) C*03 human epitope
                 AAVDLSHFL Nef(83-91) C*03 human epitope
                 AAFDLSFFL Nef(83-91) C*06:02 human epitope
                 GAFDLSFFL Nef(83-91) C*08 human epitope
                 AAVDLSHFL Nef(83-91) C*08 human epitope
                 AAVDLSHFL Nef(83-91) C*08 human epitope
                 AAiDLSHFL Nef(83-91) susceptible form
                 gAVDLSHFL Nef(83-91) susceptible form
                 AAlDLSHFL Nef(83-91) non-susceptible form; susceptible form
                 gAlDLSHFL Nef(83-91) non-susceptible form; susceptible form
                 gAfDLSHFL Nef(83-91) non-susceptible form; susceptible form
                 GALDLSHFL Nef(83-91) C*08:02 human epitope
                 GAFDLSHFL Nef(83-91) C*08:02 human epitope
                 AAVDLSHFL Nef(83-91) C*08:02 human epitope
                 AAVDLSHFL Nef(83-91) C*17 human epitope
                 AALDLSHFL Nef(83-91) Cw3 human epitope
                 AALDLSHFL Nef(83-91) Cw3 human epitope
                 AALDMSHFL Nef(83-91) Cw3 human epitope
                 AALDiSHFL Nef(83-91) susceptible form
                 gALDMSHFL Nef(83-91) diminished response
                 AAVDLSHFL Nef(83-91) Cw8 human epitope
                 GALDLSFFL Nef(83-91) human epitope
                 GAfDLSFFL Nef(83-91) observed variant
                 GAVDLSHFL Nef(83-91) human epitope
                 AAVDLSHFL Nef(83-91) human epitope
                 GAFDLSFFLK Nef(83-92) A*11 human epitope
                 AAVDLSHFLK Nef(83-92) A11 human epitope
                 AAVDLSHFLK Nef(83-92) A11 human epitope
                 vAlDLSHFLK Nef(83-92) susceptible form
                 GAFDLSFFLK Nef(83-92) A11 human epitope
                 AAVDLSHFLK Nef(83-92) A*11:01 human epitope
                 AAVDLSHFLKEK Nef(83-94) A11 human epitope
                 GALDLSHFLKEKGGL Nef(83-97) A3 human epitope
                  ALDLSHFL Nef(84-91) A2 human epitope
                  AVDLSHFL Nef(84-91) A2 human epitope
                  AVDLSHFL Nef(84-91) B62 human epitope
                  AfDLSHFL Nef(84-91) observed variant
                  AiDLSHFL Nef(84-91) observed variant
                  AlDLSHFL Nef(84-91) observed variant
                  AVDLSHFL Nef(84-91) B62 human epitope
                  AVDLSHFL Nef(84-91) B62 human epitope
                  AVDLSHFLK Nef(84-92) A*03 human epitope
                  AVDLSHFLK Nef(84-92) A*03 human epitope
                  AmDLSHFLK Nef(84-92) observed variant
                  AVDLSHFLK Nef(84-92) A*03, A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*03, A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*03:01 human epitope
                  ALDLSHFLR Nef(84-92) A*03:01 human epitope
                  AvDLSHFLk Nef(84-92) non-susceptible form; susceptible form
                  ALDLSHFLk Nef(84-92) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                  AVDLSHFLK Nef(84-92) A*03:01 human epitope
                  AlDLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlDLSHFLr Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlDiSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlnLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AlDmSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AVDLSHFLK Nef(84-92) A*03:01 human epitope
                  AVDLSHFLK Nef(84-92) A*03:01, A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*11 human epitope
                  AVDLSHFLK Nef(84-92) A*11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human, macaque epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AVDLSHFLK Nef(84-92) A11 human epitope
                  AfDLSHFLr Nef(84-92) diminished HLA binding or increased off-rate
                  ArDLSHFLK Nef(84-92) diminished HLA binding or increased off-rate
                  AlDLSHFLK Nef(84-92) susceptible form
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AlDLSHFLK Nef(84-92) observed variant
                  AfDLSHFLK Nef(84-92) diminished HLA binding or increased off-rate
                  AiDLSHFLK Nef(84-92) observed variant
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, A3 human epitope
                  AVDLSHFLK Nef(84-92) A11, Cw8 human epitope
                  ALDLSHFLK Nef(84-92) A*11:01 human epitope
                  AvDLSHFLK Nef(84-92) non-susceptible form
                  ALDLSHFLr Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  ALDiSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  ALnLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  ALDmSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLr Nef(84-92) escape documented in this paper
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  ALDLSHFLK Nef(84-92) A*11:01 human epitope
                  ALDLSHFLr Nef(84-92) escape documented in this paper
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AfDLSfFLK Nef(84-92) diminished HLA binding or increased off-rate; subtype-specific non-susceptible form
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A*11:01 human epitope
                  AVDLSHFLK Nef(84-92) A3 human epitope
                  AVDLSHFLK Nef(84-92) A3 human epitope
                  AVDLSHFLK Nef(84-92) A3 human epitope
                  AVDLSHFLK Nef(84-92) B*15:03 human epitope
                  AVDLSHFLK Nef(84-92) B*15:17 human epitope
                  AVDLSHFLK Nef(84-92) C*08 human epitope
                  AVNLSHFLK Nef(84-92) human epitope
                  AVdLSHFLK Nef(84-92) susceptible form
                  AVDLSHFLK Nef(84-92) human epitope
                  AlDLSHFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLgHFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLaHFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLSfFLK Nef(84-92) non-susceptible form
                  AVDLSaFLK Nef(84-92) non-susceptible form
                  AVDaSHFLK Nef(84-92) non-susceptible form; susceptible form
                  AfDLSfFLK Nef(84-92) non-susceptible form; susceptible form
                  AVDLSHFLK Nef(84-92) human epitope
                  AVDLSHFLK Nef(84-92) human epitope
                  AVnLSHFLK Nef(84-92) susceptible form
                  AVDLSHFLK Nef(84-92) human epitope
                  ALDLSHFLK Nef(84-92) human epitope
                  AvDLSHFLK Nef(84-92) observed variant
                  AVDLSHFLK Nef(84-92) human epitope
                  AlDLSHFLK Nef(84-92) subtype-specific susceptible form
                  AfDLSfFLK Nef(84-92) subtype-specific susceptible form
                  ALDLSHFLK Nef(84-92) human epitope
                  AFDLSFFLK Nef(84-92) human epitope
                   VDLSHFLK Nef(85-92) A*11:01 human epitope
                   VDLSHFLKEKGGLEGL Nef(85-100) A*02:01 human epitope
                    DLSHFLK Nef(86-92) A*11:01 human epitope
                    DLSHFLKEK Nef(86-94) A*03, A*11 human epitope
                    DLSfFLKEK Nef(86-94) observed variant
                    DLSfFLiEK Nef(86-94) observed variant
                    DLSfFLrEK Nef(86-94) observed variant
                    DLSfFLKEq Nef(86-94) observed variant
                    DLSfFLrEq Nef(86-94) observed variant
                    DLSHFLKEK Nef(86-94) A*03:01 human, macaque epitope
                    DLSHFLKEK Nef(86-94) A*03:01 human epitope
                    DLSHFLKEK Nef(86-94) A*03:01 human epitope
                    DLSHFLKEK Nef(86-94) A*03:01, A11 human epitope
                    DLSFLKEK Nef(86-94) A11, A3 human epitope
                    DLSHFLKEK Nef(86-94) A3 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) A2 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) B35 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) B35, Cw4 human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) human epitope
                    DLSHFLKEKGGLEGL Nef(86-100) human epitope
                     LSHFLKEKGGLEG Nef(87-99) human epitope
                     FSHFLKEKGGLEGLIY Nef(87-102) human epitope
                     lSHFLKEKGGLdGLIY Nef(87-102) observed variant
                     lSHFLKEKGGLEGLIY Nef(87-102) observed variant
                     lSHFLKEKGGLEGLIw Nef(87-102) observed variant
                     lSfFLKEKGGLEGLIY Nef(87-102) observed variant
                      SHFLKEKGGLEGL Nef(88-100) human epitope
                      SfFLKEKGGLEGL Nef(88-100) observed variant
                      SFFLKEKGGLEGLIYSKK Nef(88-105) C*05 human epitope
                      SFFLKEKGGLEGLIYSKK Nef(88-105) human epitope
                      SHFLKEKGGLEGLIYSQK Nef(88-105) human epitope
                      SfFLKEKGGLEGLIYSkK Nef(88-105) subtype-specific susceptible form
                      SHFLKEKGGLEGLIYSQK Nef(88-105) human epitope
                       HFLKEKGGL Nef(89-97) human epitope
                       FFLKEKGGLEGLIYS Nef(89-103) human epitope
                       FFLKEKGGLEGLIHSQKR Nef(89-106) human epitope
                       HFLKEKGGLEGLIYSQKR Nef(89-106) human epitope
                        FLKEKGGL Nef(90-97) A*02:01 human epitope
                        FLKEKGGL Nef(90-97) A2, B8 human epitope
                        FLKEqGGL Nef(90-97) observed variant
                        FLKEKGGL Nef(90-97) A3 human epitope
                        FLKEKGGL Nef(90-97) B*07 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLrEKGGL Nef(90-97) literature escape
                        FLKdKGGL Nef(90-97) literature escape
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEnGGL Nef(90-97) literature escape; processing
                        FLKEmGGL Nef(90-97) literature escape; processing
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLrEKGGL Nef(90-97) diminished response
                        FLrdKGGL Nef(90-97) escape documented in this paper
                        FLKErGGL Nef(90-97) diminished response
                        FLrkeGGL Nef(90-97) observed variant
                        FLKEqGGL Nef(90-97) diminished response; susceptible form
                        FLKEmGGL Nef(90-97) diminished response
                        FLKEnGGL Nef(90-97) diminished response
                        FLKEtGGL Nef(90-97) diminished response
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEKGGL Nef(90-97) B*08 human epitope
                        FLKEqGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEeGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKdKGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        sLKEKGGL Nef(90-97) susceptible form
                        lLKEKGGL Nef(90-97) susceptible form
                        FiKEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLeEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKgnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        -------- Nef(90-97) epitope loss
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEqGGL Nef(90-97) escape documented in this paper; literature escape; non-susceptible form
                        FLKEeGGL Nef(90-97) escape documented in this paper; literature escape; non-susceptible form
                        FLKEnGGL Nef(90-97) escape documented in this paper; literature escape; non-susceptible form; susceptible form
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEqGGL Nef(90-97) non-susceptible form; susceptible form
                        FLKEtGGL Nef(90-97) non-susceptible form; susceptible form
                        FLKEnGGL Nef(90-97) diminished response; non-susceptible form
                        FLKEmGGL Nef(90-97) diminished response; non-susceptible form; susceptible form
                        FLKEeGGL Nef(90-97) diminished response; non-susceptible form
                        FLrEKGGL Nef(90-97) diminished response; non-susceptible form
                        FLKdKGGL Nef(90-97) non-susceptible form; susceptible form
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEtGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEnGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEmGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEqGGL Nef(90-97) escape documented in this paper; susceptible form; TCR related mutation
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEqGGL Nef(90-97) escape documented in this paper
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLrEKGGL Nef(90-97) literature escape
                        FLKEeGGL Nef(90-97) literature escape
                        FLKEKGGL Nef(90-97) B*08:01 human epitope
                        FLKEKGGL Nef(90-97) B*35:01, B*35:08 human epitope
                        FLKEKGGL Nef(90-97) B*40 human epitope
                        FLKEKGGL Nef(90-97) B*57 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEeGGL Nef(90-97) escape documented in this paper
                        FLKEgGGL Nef(90-97) observed variant
                        FLKgeGGL Nef(90-97) observed variant
                        FLKveGGL Nef(90-97) observed variant
                        cLKEKGGL Nef(90-97) observed variant
                        sLKEKGGL Nef(90-97) observed variant
                        FLKEeGGL{p} Nef(90-97) observed variant
                        FLKEKGGL Nef(90-97) B8 epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 epitope
                        FLKEnGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEeGGL Nef(90-97) diminished HLA binding or increased off-rate; escape documented in this paper
                        FLKEqGGL Nef(90-97) susceptible form
                        FLKdKGGL Nef(90-97) diminished response
                        FLeEnGGL Nef(90-97) non-susceptible form
                        FLKgnGGL Nef(90-97) non-susceptible form
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human, macaque epitope
                        FLKEMGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        SLKEKGGL Nef(90-97) B8 human epitope
                        LLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEnGGL Nef(90-97) inferred escape
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL? Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 human epitope
                        FLKEKGGL Nef(90-97) B8 epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKErGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEmGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEtGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEeGGL Nef(90-97) HLA association; TCR related mutation
                        FLrEKGGL Nef(90-97) HLA association; TCR related mutation
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGL Nef(90-97) human epitope
                        FLKEKGGLEGL Nef(90-100) A2 human epitope
                        FLKEKGGLEGLIYSK Nef(90-104) human epitope
                        FLKEKGGLEGLIYSK Nef(90-104) human epitope
                        FLKEKGGLEGLIHSQ Nef(90-104) human epitope
                        FLKEKGGLEGLIYSK Nef(90-104) human epitope
                         LKEKGGLEGLIYSQKRQDIL Nef(91-110) human epitope
                          KEKGGLEGL Nef(92-100) B*35:02, B*35:03, B*53:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLDGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLdGL Nef(92-100) diminished response
                          KEKGGLEeL Nef(92-100) inferred escape
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLdGL Nef(92-100) subtype-specific non-susceptible form; subtype-specific susceptible form
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B*40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B40 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGm Nef(92-100) inferred escape
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:01 human epitope
                          KEKGGLEGL Nef(92-100) B*40:02 human epitope
                          KEKGGLEGL Nef(92-100) B*40:02 human epitope
                          KEKGGLEGL Nef(92-100) B*44:03 human epitope
                          KEKGGLEGL Nef(92-100) B*44:03 human epitope
                          KEKGGLEGL Nef(92-100) B*55 human epitope
                          KEKGGLEGL Nef(92-100) B*60, B*61 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KgKGGLEGL Nef(92-100) escape documented in this paper
                          KkKGGLEGL Nef(92-100) escape documented in this paper
                          KEnGGLErL Nef(92-100) inferred escape
                          KEKrGLErL Nef(92-100) inferred escape
                          KEKGGLkGL Nef(92-100) inferred escape
                          KEKGGLdGL Nef(92-100) inferred escape
                          KEKGGLErL Nef(92-100) inferred escape
                          KEKGGLEeL Nef(92-100) inferred escape
                          KEKGGLEGp Nef(92-100) inferred escape
                          KEKGGLEGi Nef(92-100) inferred escape
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGL Nef(92-100) B60 human epitope
                          KEKGGLEGi Nef(92-100) escape documented in this paper
                          KkKGGLEGL Nef(92-100) escape documented in this paper
                          KEKGGLEGp Nef(92-100) escape documented in this paper
                          KEKGGLEeL Nef(92-100) escape documented in this paper
                          KEKGGLErL Nef(92-100) escape documented in this paper
                          KEKrGLErL Nef(92-100) escape documented in this paper
                          KEnGGLEGL Nef(92-100) escape documented in this paper
                          KEKGGLEGL Nef(92-100) human epitope
                          KEKGGLEGi Nef(92-100) HLA association; susceptible form
                          KEKGGLEGLIY Nef(92-102) B*44:03 human epitope
                          KEKGGLEGLIY Nef(92-102) B*44:03 human epitope
                          KEKGGLEGLIY Nef(92-102) B*44:03 human epitope
                          KEKGGLEGLVYSQK Nef(92-105) human epitope
                          KEKGGLEGLIHSQRRQDILDL Nef(92-112) human epitope
                          KEKGGLEGLIHSQRRQDILDL Nef(92-112) human epitope
                          KEKGGLEGLIHSQRRQDILDL Nef(92-112) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health