HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

QEEEEVGFPVRPQVPLRPMT Nef(61-80) human epitope
 EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
 EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
 EEEEVGFVTPQVPLRPMTY Nef(62-81) human epitope
 EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
  EEEVGFPVKPQVPLR Nef(63-77) B7 human epitope
  EEEVGFPVRPQVPLR Nef(63-77) human epitope
  EEEVGFPVRPQVPLR Nef(63-77) human epitope
    EVGFPVRPQVPLRPM Nef(65-79) human epitope
    EVGFPVRPQVPLRPM Nef(65-79) human epitope
    EVGFPVRPQVPLRPMTFK Nef(65-82) C*03, C*04, C*12 human epitope
    EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
    EVGFPVtPQVPLRPMTYK Nef(65-82) observed variant
    EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
    EVGFPVRPQVPLRPMTfK Nef(65-82) subtype-specific susceptible form
    EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
    EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
    DVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
    eVGFPVRPQVPLRPMTYK Nef(65-82) observed variant
     VGFPVTPQVPLRMT Nef(66-80) A1, B8 human epitope
     VGFPVTPQVPLRMT Nef(66-80) A1, B8 human epitope
     VGFPVTPQVPLRPMTYK Nef(66-82) A*11:01 human epitope
     VGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGL Nef(66-97) human epitope
      GFPVRPQVPLRPMTY Nef(67-81) human epitope
      GFPVRPQVPLRPMTY Nef(67-81) human epitope
      GFPVRPQVPLRPMTY Nef(67-81) human epitope
       FPVTPQVPLR Nef(68-77) A*68:02 human epitope
       FPVTPQVPLR Nef(68-77) B*07 human epitope
       FPVTPQVPLR Nef(68-77) B*07 human epitope
       FPVTPQVPLR Nef(68-77) B*07 human, transgenic mouse epitope
       FPVrPQVPLR Nef(68-77) non-susceptible form
       FPVTPQVPLR Nef(68-77) B*07, B*35 human epitope
       FPVKPQVPLR Nef(68-77) B*07:02 human epitope
       FPVrPQVPLR Nef(68-77) non-susceptible form
       FPVtPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
       FPVTPQVPLR Nef(68-77) B*07:02 human epitope
       FPVRPQVPLR Nef(68-77) B*07:02 human epitope
       FPVkPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
       FPVkPQVPvR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
       FPVkPQePLi Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
       FPVtPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
       FPVtPQVPLt Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
       FPVTPQVPLR Nef(68-77) B*07:02 human epitope
       FPVRPQVPLR Nef(68-77) B7 human epitope
       FPVRPQVPLR Nef(68-77) B7 human epitope
       FPVRPQVPLR Nef(68-77) B7 human epitope
       FPVtPQVPLR Nef(68-77) observed variant
       FPVTPQVPLR Nef(68-77) B7 human epitope
       FPVTPQVPLR Nef(68-77) B7 human epitope
       FPVTPQVPLR Nef(68-77) B7 human epitope
       FPVTPQVPLR Nef(68-77) B7 human epitope
       FPVTPQVPLR Nef(68-77) B7 human epitope
       FPVTPQVPLR Nef(68-77) B7 human epitope
       FPVTPQVPLR Nef(68-77) B*81 human epitope
       FPVRPQVPLR Nef(68-77) human epitope
       FPVkPQVPLR Nef(68-77) altered HLA expression
       FPVTPQVPLR Nef(68-77) human epitope
       FPVTPQVPLR Nef(68-77) human epitope
       FPVTPQVPLRMTY Nef(68-81) human epitope
       FPVrPQVPLRMTY Nef(68-81) observed variant
       FPVkPQVPLRMTY Nef(68-81) observed variant
       FPVTPQVPLRPMTFK Nef(68-82) A3 human epitope
       FPVRPQVPLRPMTYK Nef(68-82) A3 human epitope
       FPVRPQVPLRPMTYK Nef(68-82) B35 human epitope
       FPVRPOVPLRPMTYK Nef(68-82) human epitope
       FPVRPQVPLRPMTYKGA Nef(68-84) human epitope
       FPVRPQVPLRPMTYKaA Nef(68-84) observed variant
        PVKPQVPLR Nef(69-77) human epitope
        PVRPQVPLRPMTYKA Nef(69-83) human epitope
        PVRPQVPLRPMTfKA Nef(69-83) observed variant
         VTPQVPLRPMTYKAA Nef(70-84) human epitope
          TPQVPLRPM Nef(71-79) A*30 human epitope
          TPQVPLRPM Nef(71-79) A*34 human epitope
          TPQVPLRPM Nef(71-79) A*68:02 human epitope
          TPQVPLRPM Nef(71-79) B*07 human epitope
          RPQVPLRPM Nef(71-79) B*07 human epitope
          TPQVPLRPM Nef(71-79) B*07 human epitope
          RPQVPLRPM Nef(71-79) B*07, B*81:01 human epitope
          TPQVPLRPM Nef(71-79) B*07:02 human epitope
          RPQVPLRPM Nef(71-79) B*07:02 human epitope
          kPQVPLRPM Nef(71-79) inferred escape
          RPQVPLRPM Nef(71-79) B*07:02 human epitope
          RPQVPLRPM Nef(71-79) B*07:02, B*42:01, B*81:01, B7, B81 human epitope
          RPQVPLRPM Nef(71-79) B*07:02, B*81:01 human epitope
          RPQVPLRPM Nef(71-79) B*07:02, B*81:01 human epitope
          RPQVPvRPM Nef(71-79) altered HLA expression; observed variant; replicative capacity reduced
          TPQVPLRPM Nef(71-79) B*35 human epitope
          TPQVPLRPM Nef(71-79) B35 human epitope
          RPQVPLRPM Nef(71-79) B*35:01 human epitope
          RPQVPLRPM Nef(71-79) B*35:02, B*35:03, B*53:01 human epitope
          RPQVPLRPM Nef(71-79) B*39 human epitope
          RPQVPLRPM Nef(71-79) B*42 human epitope
          RPQVPLRPM Nef(71-79) B*42 human epitope
          RPQVPLRPM Nef(71-79) B42 human epitope
          TPQVPLRPM Nef(71-79) B42 human epitope
          RPQVPLRPM Nef(71-79) B*42:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:01, B*42:02 human epitope
          RPQQVPLRPM Nef(71-79) B*42:01, B*81:01 human epitope
          RPQVPLRPM Nef(71-79) B*42:02 human epitope
          RPQVPLRPM Nef(71-79) B*42:02 epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          RPQVPLRPM Nef(71-79) B7 human epitope
          tPQVPLRPM Nef(71-79) observed variant
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B7 human epitope
          TPQVPLRPM Nef(71-79) B*78 human epitope
          RPQVPLRPM Nef(71-79) B*78 human epitope
          TPQVPLRPM Nef(71-79) B7 supertype human epitope
          RPQVPLRPM Nef(71-79) B*81 human epitope
          RPQVPLRPM? Nef(71-79) B81 human epitope
          RPQVPLRPM Nef(71-79) B*81:01 human epitope
          RPQVPLRPM Nef(71-79) B*81:01 human epitope
          RPQVPvRPM Nef(71-79) literature escape
          RPQaPLRPM Nef(71-79) observed variant
          kPQVPLRPM Nef(71-79) observed variant
          RPQVPiRPM Nef(71-79) literature escape
          RPQVPtRPM Nef(71-79) literature escape
          RPQVPLRPM Nef(71-79) B*81:01 human epitope
          RPQVPvRPM Nef(71-79) calculated escape
          RPQVPtRPM Nef(71-79) observed variant
          RPQVPmRPM Nef(71-79) observed variant
          RPQmPLRPM Nef(71-79) observed variant
          kPQVPvRPM Nef(71-79) observed variant
          RPQVPiRPM Nef(71-79) observed variant
          tPQVPIRPM Nef(71-79) observed variant
          RPQVPLRPM Nef(71-79) B*82 human epitope
          RPQVPLRPM Nef(71-79) C*04 human epitope
          RPQVPLRPM Nef(71-79) C*17 human epitope
          RPQVPLRPM Nef(71-79) human epitope
          kPQVPLRPM Nef(71-79) susceptible form
          tPQVPLRPM Nef(71-79) observed variant
          RPQVPvRPM Nef(71-79) escape documented in this paper
          RPQVPtRPM Nef(71-79) escape documented in this paper
          tPQVPLkPM Nef(71-79) observed variant
          RPQaPLRPM Nef(71-79) observed variant
          RPQVPmRPM Nef(71-79) observed variant
          kPQVPvRPM Nef(71-79) observed variant
          RPQmPLRPM Nef(71-79) observed variant
          RPQVPiRPM Nef(71-79) escape documented in this paper
          cPQVPLRPM Nef(71-79) observed variant
          RPQVrLRPM Nef(71-79) observed variant
          RPQVlLRPM Nef(71-79) observed variant
          RPQVPLRPM Nef(71-79) human epitope
          TPQVPLRPMTY Nef(71-81) B*07, B*35 human epitope
          RPQVPLRPMTY Nef(71-81) B*35 human epitope
          RPQVPLRPMTY Nef(71-81) B*35 human epitope
          tPQVPLRPMTY Nef(71-81) diminished response
          RPQVPLRPMTY Nef(71-81) B*35 human epitope
          RPQVPLRPMTf Nef(71-81) susceptible form
          tPQVPLRPMTY Nef(71-81) escape documented in this paper
          tPQVPLRPMTf Nef(71-81) observed variant
          RPQVPLRPMTY Nef(71-81) B35 human epitope
          kPQVPLRPMTY Nef(71-81) altered HLA expression; observed variant; replicative capacity reduced
          RPQVPLRPMTY Nef(71-81) B35 human epitope
          tPQVPLRPMTY Nef(71-81) escape documented in this paper; TCR related mutation
          RPQVPLRPMTY Nef(71-81) B35 human epitope
          RPQVPLRPMTY Nef(71-81) B35 human epitope
          tPQVPLRPMTY Nef(71-81) escape documented in this paper
          tPQVPLRPMTf Nef(71-81) escape documented in this paper
          TPQVPLRPMTY Nef(71-81) B35 human epitope
          RPQVPLRPMTY Nef(71-81) B35 human epitope
          RPQVPLRPMTf Nef(71-81) susceptible form
          RPQVPLRPMTY Nef(71-81) B35 human epitope
          RPQVPLRPMTY Nef(71-81) B35 human epitope
          RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
          RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
          RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
          tPQVPLRPMTY Nef(71-81) escape documented in this paper
          tPQVPLRPMTf Nef(71-81) escape documented in this paper
          RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
          RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
          RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
          RPQVPLRPMTf Nef(71-81) observed variant; replicative capacity is not abrogated
          kPQVPLRPMTY Nef(71-81) observed variant; replicative capacity is not abrogated
          RPQVPLRPMdY Nef(71-81) observed variant; replicative capacity is not abrogated
          RPQVPLRPMTY Nef(71-81) B51 human, macaque epitope
          TPQVPLRPMTY Nef(71-81) B7 human epitope
          TPQVPLRPMTY Nef(71-81) B7 supertype human epitope
          rPQVPLRPMTY Nef(71-81) susceptible form
          RPQVPLRPMTY Nef(71-81) human epitope
          RPQVPLRaMTY Nef(71-81) HLA association
          KPQVPLRPMTYKAAV Nef(71-85) A3, B35 human epitope
          RPQVPLRPMTYKAAL Nef(71-85) human epitope
          RPQVPLRPMTYKAAL Nef(71-85) human epitope
          RPQVPLRPMTYKAAL Nef(71-85) human epitope
          RPQVPLRPMTYKAAVDLSHF Nef(71-90) human epitope
           PQVPLRPMTY Nef(72-81) B35 human epitope
           PQVPLRPMTY Nef(72-81) B35, B51 human epitope
           PQVPLRPMTY Nef(72-81) B*51 human epitope
           PQVPLRPMTYKGAFD Nef(72-86) human epitope
           PQVPLRPMTYKAAVDLSHFL Nef(72-91) human epitope
           PQVPLRMTYKAAVDLSHFL Nef(72-91) human epitope
           PQVPLRRMTYKAAVDLSHFL Nef(72-91) human epitope
            QVPLRPMTY Nef(73-81) A1 human epitope
            QVPLRPMTY Nef(73-81) A*80:01 human epitope
            QVPLRPMTY Nef(73-81) B*07 human epitope
            QVPLRPMTY Nef(73-81) B*35 human epitope
            QVPLRPMTY Nef(73-81) B*35:01 human epitope
            QVPLRPMTY Nef(73-81) human epitope
            QVPvRPMTY Nef(73-81) susceptible form
            QaPLRPMTY Nef(73-81) non-susceptible form; susceptible form
            QVPLRPMTf Nef(73-81) non-susceptible form; susceptible form
            QVPaRPMTY Nef(73-81) non-susceptible form; susceptible form
            QVPLRaMTY Nef(73-81) non-susceptible form; susceptible form
            QVPLaPMTY Nef(73-81) non-susceptible form; susceptible form
            QVPLRPMTYK Nef(73-82) A*02:01 human epitope
            QVPLRPMTYK Nef(73-82) A*02:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03 human epitope
            QVPLRPMTYK Nef(73-82) A*03 human epitope
            QVPLRPMTYK Nef(73-82) A*03 human epitope
            QVPLRPMTYK Nef(73-82) A*03 human epitope
            QVPLRPMTYK Nef(73-82) A*03 human epitope
            QVPLRPMTYK Nef(73-82) A*03 human epitope
            QVPLRPMTYK Nef(73-82) A*03, A*11, A*31, B*27, B*35 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QiPLRPMTYK Nef(73-82) susceptible form
            QVPLaPMTYK Nef(73-82) diminished response
            QVPLgPMTYK Nef(73-82) diminished response
            QVPLgPMsYK Nef(73-82) susceptible form
            QVPLRPMaYK Nef(73-82) diminished response
            QVPLRPaTYK Nef(73-82) diminished response
            aVPLRPMTYK Nef(73-82) susceptible form
            QaPLRPMTYK Nef(73-82) susceptible form
            QVaLRPMTYK Nef(73-82) susceptible form
            QVPaRPMTYK Nef(73-82) susceptible form
            QVPLRaMTYK Nef(73-82) susceptible form
            QVPLRPMTaK Nef(73-82) susceptible form
            QVPLRPMTYa Nef(73-82) susceptible form
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTeK Nef(73-82) diminished response
            QVPvRPMTYK Nef(73-82) diminished response
            QVPiRPMTYK Nef(73-82) diminished response
            QVPLRPMTYq Nef(73-82) diminished response
            QVPLRPMTrr Nef(73-82) non-susceptible form
            QVPLRPMTYr Nef(73-82) non-susceptible form; susceptible form
            hVPLRPMTYK Nef(73-82) diminished response; susceptible form
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK{gA} Nef(73-82) inferred escape
            QVPLRPMTfK{gA} Nef(73-82) inferred escape
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01 human epitope
            QVPLRPMTYK Nef(73-82) A*03:01, A*11 human epitope
            QiPLRPMTYK Nef(73-82) diminished HLA binding or increased off-rate; observed variant
            QVPLRPMTYK Nef(73-82) A*03:01, A11 human, macaque epitope
            QVPLRPMTYK Nef(73-82) A*03:01, A11 human epitope
            QVPLRPMTYK Nef(73-82) A03 supertype human epitope
            QVPLRPMTYK Nef(73-82) A*11 human epitope
            QVPLRPMTYK Nef(73-82) A*11 human epitope
            QVPLRPMTYK Nef(73-82) A*11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTsr Nef(73-82) diminished HLA binding or increased off-rate
            {r*}QVPLRPMTYK{g} Nef(73-82) inferred escape; processing
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11 human epitope
            QVPLRPMTYK Nef(73-82) A11, A2, A3, B35 human epitope
            QVPLRPMTYK Nef(73-82) A11, A3 human epitope
            QVPLRPMYTK Nef(73-82) A11, A3 human epitope
            QVPLRPMTYK Nef(73-82) A11, A3 human epitope
            QVPLRPMTYK Nef(73-82) A11, A3 human epitope
            QVPLRPMTYK Nef(73-82) A11, A3 human epitope
            QVPvRPMTYK Nef(73-82) observed variant
            QVPmRPMTYK Nef(73-82) observed variant
            QVPLRPMTfK Nef(73-82) susceptible form
            QVPLRPMTYK Nef(73-82) A11, A3, A30 epitope
            QVPLRPMTYK Nef(73-82) A11, A3, B35 human epitope
            QVPLRPMTYK Nef(73-82) A*11:01 human epitope
            QVPLRPMTYK Nef(73-82) A*11:01 human epitope
            QVPLRPMTYK Nef(73-82) A*11:01 human epitope
            QVPLRPMTYK Nef(73-82) A*11:01 human epitope
            QVPLRPMTYK Nef(73-82) A*11:01 epitope
            QVPLRPMTYK Nef(73-82) A*11:01 human epitope
            QVPLRRMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRRMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTfK Nef(73-82) susceptible form
            QVPLkPMTfK Nef(73-82) diminished response
            QVPLRPMnYK Nef(73-82) diminished response
            QVPvRPMTfK Nef(73-82) escape documented in this paper
            QVPLRPMsYr Nef(73-82) escape documented in this paper
            QVPLRPMsYK Nef(73-82) susceptible form
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            QVPLRPMTYK Nef(73-82) A3 human epitope
            {k*}QVPLRPMTYK{g} Nef(73-82) escape documented in this paper; processing
            QVPLRPMTYK Nef(73-82) A*33 human epitope
            QVPLRPMTYK Nef(73-82) A*34 human epitope
            QVPLRPMTYK Nef(73-82) A3 supertype human epitope
            QVPLRPMTYK Nef(73-82) A*66 human epitope
            QVPLRPMTYK Nef(73-82) B*08 human epitope
            QVPLRPMTYK Nef(73-82) B27 human epitope
            SVPLRPMTYK Nef(73-82) B35, Cw4 human epitope
            QVPLRPMTYK Nef(73-82) B*35:02, B*35:03, B*53:01 human epitope
            QVPLRPMTYK Nef(73-82) B8 human epitope
            SVPLRPMTYK Nef(73-82) C*04 human epitope
            QVPVRPMTYK Nef(73-82) C*08 human epitope
            QVPLRPMTYK Nef(73-82) human epitope
            QVPLRPMTYK Nef(73-82) human epitope
            QVPLRPMTYK Nef(73-82) human epitope
            QVPLRPMTYK Nef(73-82) human epitope
            QVPLRPMTYK Nef(73-82) human epitope
            QVPLRPMTYKA Nef(73-83) A3 human epitope
            QVPLRPMTYKAAVDL Nef(73-87) B57 human epitope
            QVPLRPMTYKAAVDL Nef(73-87) human epitope
            QVPLRPMTfKAAVDL Nef(73-87) observed variant
            QVPLRPMTYKAAVDL Nef(73-87) human epitope
            AVPLRPMTYKAAFDLSFF Nef(73-90) A*68:02 human epitope
            QVPLRPMTYKAAVDLSHF Nef(73-90) human epitope
            QVPLRPMTYKGALDLSHF Nef(73-90) human epitope
            QVPLRPMTYKAAFDLSFFLKEKG Nef(73-95) human epitope
             VPLRPMTY Nef(74-81) A*11 human epitope
             VPLRPMTY Nef(74-81) A3 human epitope
             VPLRPMTY Nef(74-81) B*07 human epitope
             VPLRPMTY Nef(74-81) B*35 human epitope
             VPLRPMTY Nef(74-81) B*35 human epitope
             VPLRPMTY Nef(74-81) B*35 human epitope
             VPLRPMTY Nef(74-81) B*35 epitope
             VPLRPMTY Nef(74-81) B*35 human epitope
             VPLRPMTf Nef(74-81) literature escape
             VPLRPMTY Nef(74-81) B*35 human epitope
             VPLRPMTY Nef(74-81) B*35, B*53 human epitope
             VPLRPMTf Nef(74-81) escape documented in this paper
             lPLRPMTY Nef(74-81) observed variant
             VPLRPiTY Nef(74-81) observed variant
             VPLRPMTt Nef(74-81) observed variant
             VPLRPMnY Nef(74-81) observed variant
             VPLRPMTY Nef(74-81) B*35, B*53:01 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTf Nef(74-81) escape documented in this paper
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMsY Nef(74-81) escape documented in this paper
             VPLRPMTf Nef(74-81) escape documented in this paper
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35 human, macaque epitope
             VPLRPMTY Nef(74-81) B35 human epitope
             VPLRPMTY Nef(74-81) B35, B42 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTf Nef(74-81) diminished response
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPvRPMTY Nef(74-81) observed variant; susceptible form
             VPLRPMTf Nef(74-81) diminished response; non-susceptible form; TCR related mutation
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTf Nef(74-81) escape documented in this paper
             VPLRPMTF Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:01 human epitope
             VPLRPMTY Nef(74-81) B*35:02, B*35:03, B*53:01 human epitope
             VPLRPMTY Nef(74-81) B*55 human epitope
             VPLRPMTY Nef(74-81) B*78 human epitope
             VPLRPMTY Nef(74-81) B*81 human epitope
             VPLRPMTY Nef(74-81) C*12 human epitope
             VPLRPMTY Nef(74-81) human epitope
             VPLRPMTY Nef(74-81) human epitope
             VPLRPMTYK Nef(74-82) A11 human epitope
             VPLRPMTFK Nef(74-82) human epitope
             VPLRPMTYKA Nef(74-83) B7 human epitope
             VPLRPMTYRAARDLS Nef(74-88) B7 supertype human epitope
             IPLRPMTYKGALDLS Nef(74-88) B7 supertype human epitope
              PLRPMTYK Nef(75-82) A11 human epitope
              PLRPMYTK Nef(75-82) A11 human epitope
              PLRPMTYK Nef(75-82) A*11:01 human epitope
              PLRPMTYK Nef(75-82) A*11:01 human epitope
              PLRPMTYK Nef(75-82) B*15:01 human epitope
              PLRPMTYK Nef(75-82) C*02 human epitope
              PLRPMTYKAALDLSH Nef(75-89) human epitope
               LRPMTYKAA Nef(76-84) B*27:03 human epitope
               LRPMTYKAA Nef(76-84) B*27:03 human epitope
                RPMTYKAAL Nef(77-85) A*32 human epitope
                RPMTYKAAL Nef(77-85) B*07 human epitope
                RPMTYKAAL Nef(77-85) B*07 human epitope
                RPMTYKAAL Nef(77-85) B*07 human, transgenic mouse epitope
                RPMTYKgAL Nef(77-85) susceptible form
                RPMTYKAAv Nef(77-85) susceptible form
                RPMTfKAAL Nef(77-85) susceptible form
                RPMTYKfAL Nef(77-85) susceptible form
                RPMTYKAAf Nef(77-85) susceptible form
                RPMTYKGAL Nef(77-85) B*07 human epitope
                RPMTYKAAV Nef(77-85) B*07 human epitope
                RPMTYKAAV Nef(77-85) B*07 human epitope
                RPMTYKAAL Nef(77-85) B*07 human epitope
                RPMTYKAAL Nef(77-85) B*07 human epitope
                RPMTYKAAL Nef(77-85) B*07 human epitope
                RPMThqAAw Nef(77-85) diminished response; susceptible form
                RPMTYKAAL Nef(77-85) B*07:02 human epitope
                RPMTYKGAL Nef(77-85) B*07:02 human epitope
                RPMTfKGAL Nef(77-85) inferred escape; literature escape
                RPMTFKGAL Nef(77-85) B*07:02 human epitope
                RPMTFKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTFKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTyKaAi Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTyKaAf Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTyKGAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTyKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTyKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTyKGAL Nef(77-85) susceptible form
                RPMTYKAAL Nef(77-85) B*07:02 human epitope
                RPMTYKGAL Nef(77-85) B*07:02 human epitope
                RPMTYKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                RPMTYKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                RPMTYKaAf Nef(77-85) diminished response; escape documented in this paper; susceptible form
                RPMTYKaAi Nef(77-85) diminished response; escape documented in this paper; susceptible form
                RPMTfKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTfKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                RPMTYKgAv Nef(77-85) diminished response; escape documented in this paper; susceptible form
                RPMTFKGAL Nef(77-85) B*07:02 human epitope
                RPMTYKAAL Nef(77-85) B*07:02 human epitope
                RPMTYKAAV Nef(77-85) B*07:02 human epitope
                RPMTYKAAf Nef(77-85) subtype-specific susceptible form
                RPMTYKAAL Nef(77-85) B*18 human epitope
                RPMTYKAAV Nef(77-85) B*42:01 human epitope
                RPMTFKGAF Nef(77-85) B*42:01, B*42:02 human epitope
                RPMTYKAAL Nef(77-85) B7 human epitope
                RPMTYKAAL Nef(77-85) B7 human epitope
                RPMTYKAAV Nef(77-85) B7 human epitope
                RPMTYKAAL Nef(77-85) B7 human epitope
                RPMTYKAAV Nef(77-85) B7 human epitope
                RPMTYKAAL Nef(77-85) B7 human epitope
                RPMTYKAAL Nef(77-85) B7 human epitope
                RPMTYKGAL Nef(77-85) B7 human epitope
                RPMTYKaAv Nef(77-85) observed variant
                RPMTYKaAL Nef(77-85) observed variant
                RPMTYKAAV Nef(77-85) B7 human epitope
                RPMTYKGAL Nef(77-85) B7 human epitope
                RPMTYKAAV Nef(77-85) B7 human epitope
                RPMTYKAAV Nef(77-85) B7 human epitope
                RPMTYKGAL Nef(77-85) B7 human epitope
                RPMTYrGAL Nef(77-85) observed variant
                RPMTYKaAL Nef(77-85) observed variant
                RPMTYKGAv Nef(77-85) observed variant
                RPMsYKaAL Nef(77-85) observed variant
                RPMTfKGAL Nef(77-85) observed variant
                RPMTYKAAV Nef(77-85) B7 human epitope
                RPMTYKAAl Nef(77-85) observed variant
                RPMTYKgAi Nef(77-85) non-susceptible form; susceptible form
                RPMTYKgAl Nef(77-85) observed variant
                RPMTYKgAf Nef(77-85) observed variant
                RPMTfKgAf Nef(77-85) observed variant
                RPMTfKAAV Nef(77-85) observed variant
                RPMTYKeAV Nef(77-85) observed variant
                RPMTYKAAL Nef(77-85) B7 human epitope
                RPMTYKGAL Nef(77-85) B7 supertype human epitope
                RPMTYraAr Nef(77-85) susceptible form
                RPMTYKAAL Nef(77-85) B*81 human epitope
                RPMTYKAAL Nef(77-85) B*82 human epitope
                RPMTYKAAV Nef(77-85) B*82 human epitope
                RPMTYKAAV Nef(77-85) C*08 human epitope
                RPMTYKAAL Nef(77-85) C*17 human epitope
                RPMTYKAAV Nef(77-85) human epitope
                RPMTYKAAV Nef(77-85) human epitope
                RPMTYKGAL Nef(77-85) human epitope
                RPMTYKAAV Nef(77-85) human epitope
                RPMTWKGAL Nef(77-85) human epitope
                RPMTWKAAL Nef(77-85) susceptible form
                RPMTYKGAL Nef(77-85) susceptible form
                RPMTRKAAL Nef(77-85) susceptible form
                RPMTCKGAL Nef(77-85) susceptible form
                RPMTYKAAL Nef(77-85) observed variant
                RPITYKAAL Nef(77-85) susceptible form
                RPMTYKGAVDLSHFL Nef(77-91) B62 human epitope
                RPMTYKAALDLSHFL Nef(77-91) B62 human epitope
                RPMTYKAAVDLSHFL Nef(77-91) human epitope
                RPMTfKAAVDLSHFL Nef(77-91) observed variant
                RPMTYKGAFDLSFFL Nef(77-91) human epitope
                RPMTYKAAVDLSHFLK Nef(77-92) A*02:01 human epitope
                 PMTYKAAVDLSHFLK Nef(78-92) A3 human epitope
                 PMTYKAAVDLSHFLK Nef(78-92) B62 human epitope
                 PMTYKGAFDLSHFLK Nef(78-92) B62 human epitope
                  MTYKAALDL Nef(79-87) A*02:01 mouse epitope
                  MTYKAAFDL Nef(79-87) A*02:01 human epitope
                  MTYKAALDL Nef(79-87) A2 human, humanized mouse epitope
                  MTYKAAVDL Nef(79-87) B63 human epitope
                  MTYKGALDL Nef(79-87) human epitope
                  MTYKAALDLSHFLK Nef(79-92) human epitope
                  MTYKGAFDLSHFLKE Nef(79-93) human epitope
                   TYKAAVDL Nef(80-87) A24 human epitope
                   TYKAAVDL Nef(80-87) A24 human epitope
                   TYKgAfDL Nef(80-87) observed variant
                   TfKAAVDL Nef(80-87) observed variant
                   TfKgAfDL Nef(80-87) observed variant
                   TYKeAVDL Nef(80-87) observed variant
                   TYKgAiDL Nef(80-87) observed variant
                   TYKgAlDL Nef(80-87) observed variant
                   TYKAAlDL Nef(80-87) observed variant
                   TYKAAVDLSHFLKEK Nef(80-94) human epitope
                    YKGALDLSHFL Nef(81-91) human epitope
                    YKAAVDLSHFLKEKG Nef(81-95) B57 human epitope
                    FKAALDLSHFLNEKG Nef(81-95) human epitope
                    FKAAvDLSHFLNEKG Nef(81-95) non-susceptible form
                    YKAAVDLSHFLKEKG Nef(81-95) human epitope
                    FKGAFDLSFFLKEKEGGL Nef(81-97) B*42:01 human epitope
                    FKGAFDLSFFLKEKGGL Nef(81-97) C*04 human epitope
                    YKAAVDLSHFLKEKGGL Nef(81-97) human epitope
                    YKGALDLSHFLKEKGGL Nef(81-97) human epitope
                    fKGAfDLSfFLKEKGGL Nef(81-97) subtype-specific susceptible form
                    YKGALDLSHFLKEKGGLE Nef(81-98) human epitope
                    YKGAVDLSHFLKEKGGLE Nef(81-98) human epitope
                    YKaAVDLSHFLKEKGGLEGL Nef(81-98) observed variant
                    YKaAVDLSHFLKEKGGLE Nef(81-98) observed variant
                    YKAAVDLSHFLKEKGGLEGL Nef(81-100) human epitope
                    YKgAVDLSHFLKEKGGLE Nef(81-100) observed variant
                     KAAVDLSHF Nef(82-90) B*57 human epitope
                     KgAVDLSHF Nef(82-90) observed variant
                     KAAlDLSHF Nef(82-90) observed variant
                     KrAlDLSHF Nef(82-90) observed variant
                     KgAlDLSHF Nef(82-90) observed variant
                     agAlnLSHF Nef(82-90) observed variant
                     rgAVDLSHF Nef(82-90) observed variant
                     KAAVDLSHF Nef(82-90) B*57 human epitope
                     KGAFDLSFF Nef(82-90) B*57 human epitope
                     KAAVDLSHF Nef(82-90) B*57 human epitope
                     KAAVDiSHF Nef(82-90) observed variant
                     KAAVnLSHF Nef(82-90) observed variant
                     KgAlDLSHF Nef(82-90) observed variant
                     KAAFDLSFF Nef(82-90) B*57, B*58:01 human epitope
                     KgAFDLSFF Nef(82-90) HLA association; diminished HLA binding or increased off-rate; diminished response; escape documented in this paper
                     KgAFgLSFF Nef(82-90) HLA association; observed variant
                     KAAFgLSFF Nef(82-90) observed variant
                     KgAvDLSFF Nef(82-90) observed variant; susceptible form
                     KAAFDLSFF Nef(82-90) B*57, B*58:01 human epitope
                     KAAVDLSHF Nef(82-90) B*57, B*58:01 human epitope
                     KgAVDLSHF Nef(82-90) diminished HLA binding or increased off-rate; escape documented in this paper; susceptible form
                     KAALDLSHF Nef(82-90) B57 human epitope
                     KAAFDLSFF Nef(82-90) B57 human epitope
                     KAAFDLgFF Nef(82-90) diminished response
                     KgAFDLgFF Nef(82-90) susceptible form
                     KAAFDLSFF Nef(82-90) B57 human epitope
                     KAAVDLSHF Nef(82-90) B57 human epitope
                     KSALDLSHF Nef(82-90) B57 human epitope
                     KAAVDLSHF Nef(82-90) B57 human epitope
                     KGALDLSHF Nef(82-90) B*58:01, B57 human epitope
                     KAAFDLSFF Nef(82-90) B*58:01, B57 human epitope
                     KAAFDLSFF Nef(82-90) B*57:01 human epitope
                     KAALDLSHF Nef(82-90) B*57:01 human epitope
                     KgALDLSHF Nef(82-90) diminished response
                     qAALDLSHF Nef(82-90) diminished response
                     tAALDLSHF Nef(82-90) observed variant
                     pAALDLSHF Nef(82-90) observed variant
                     KAAhDLSHF Nef(82-90) observed variant
                     KAALDiSHF Nef(82-90) observed variant
                     {l*****}qAALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                     {*****}KgALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                     {**}KAALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                     KAAFDLSFF Nef(82-90) B*57:01, B*58:01 human epitope
                     KAAFDLSFF Nef(82-90) B*57:02, B*57:03, B*58:01 human epitope
                     KAAFDLSFF Nef(82-90) B*57:02, B*57:03, B*58:01 human epitope
                     KgAFDLSFF Nef(82-90) escape documented in this paper
                     KAAFDLSFF Nef(82-90) B*57:03 human epitope
                     KAAFDLSFF Nef(82-90) B*58:01 human epitope
                     KAAFDLgFF Nef(82-90) altered HLA expression; observed variant; replicative capacity reduced
                     KAAVDLSHF Nef(82-90) B*58:01 human epitope
                     KAAFDLSFF Nef(82-90) B*58:01 human epitope
                     KAAFDLSFF Nef(82-90) B*58:01 human epitope
                     KAAFDLgFF Nef(82-90) escape documented in this paper
                     KAAFDLSFF Nef(82-90) B*58:01 human epitope
                     KAAFDLSFF Nef(82-90) B*58:01 human epitope
                     KeAFDLSFF Nef(82-90) escape documented in this paper
                     {f}KAAFDLgFF Nef(82-90) escape documented in this paper
                     KgAFDLSFF Nef(82-90) escape documented in this paper
                     KgAvDLSFF Nef(82-90) escape documented in this paper
                     rAAFDLSFF Nef(82-90) escape documented in this paper
                     KAAvDLSFF Nef(82-90) escape documented in this paper
                     {f}KAAFDLSFF Nef(82-90) escape documented in this paper
                     -----LSFF Nef(82-90) escape documented in this paper
                     KAAFDLSFF Nef(82-90) B*58:01 human epitope
                     KAAIDLSHF Nef(82-90) B*58:01 humanized mouse epitope
                     KAAmDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                     KAAlDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                     KAAvDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                     KAAIDiSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                     KAAIDLSlF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                     KGALDLSHF Nef(82-90) C*12:02 human epitope
                     KaAvDLSHF Nef(82-90) observed variant
                     KAAVDLSHF Nef(82-90) C*12:02 human epitope
                     KgAlDLSHF Nef(82-90) non-susceptible form
                     KAAVDLSFF Nef(82-90) human epitope
                     KAAFDLSFF Nef(82-90) human epitope
                     KAALDLSHF Nef(82-90) human epitope
                     KAAVDLSFF Nef(82-90) human epitope
                     KAAVDLSHFL Nef(82-91) A*11 human epitope
                     KAALDLSHFL Nef(82-91) A2 human epitope
                     KAAvDLSHFL Nef(82-91) susceptible form
                     KAAVDLSHFL Nef(82-91) B*57 human epitope
                     KAALDLSHFL Nef(82-91) B*57:01 human epitope
                     KAALDLSHlL Nef(82-91) observed variant
                     rAALDLSHFL Nef(82-91) observed variant
                     rAALDLSHlL Nef(82-91) observed variant
                     rAAvDLSHFL Nef(82-91) observed variant
                     KgALDLSHFL Nef(82-91) observed variant
                     KAAvDLSHFL Nef(82-91) observed variant
                     KAAFDLSFFL Nef(82-91) B*57:02, B*57:03, B*58:01 human epitope
                     KgAFDLSFFL Nef(82-91) HLA association
                     KAAVDLSHFL Nef(82-91) C*03 human epitope
                     KAAVDLSHFL Nef(82-91) C*08 human epitope
                     KAAVDLSHFL Nef(82-91) C*08 human epitope
                     KAAlDLSHFL Nef(82-91) susceptible form
                     KAAlDiSHFL Nef(82-91) susceptible form
                     KgAVDLSHFL Nef(82-91) susceptible form
                     KgAlDLSHFL Nef(82-91) susceptible form
                     KAAVDLSHFL Nef(82-91) C*08:02 human epitope
                     KAAFDLSFFL Nef(82-91) C*08:04 human epitope
                     KAAVDLSHFL Nef(82-91) Cw8 human epitope
                     KAAVDLSHFL Nef(82-91) Cw8 human epitope
                     KAAVDLSHFL Nef(82-91) Cw8 human epitope
                     KAAVDLSHFL Nef(82-91) Cw8 human epitope
                     KAAVDLSHFL Nef(82-91) Cw8 human epitope
                     KAAVDLSHFL Nef(82-91) Cw8 human epitope
                     KAAVDLSMFL Nef(82-91) Cw8 human epitope
                     KAAVDLSHFL Nef(82-91) Cw8 human epitope
                     KAAVDLSHFLK Nef(82-92) A*11:01 human epitope
                     KGAFDLSFFLKEKGG Nef(82-96) human epitope
                     KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
                     KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
                      AAVDLSHF Nef(83-90) B*62 human epitope
                      gAfDLSfF Nef(83-90) observed variant
                      gvfDLSfF Nef(83-90) observed variant
                      ggfDLSfF Nef(83-90) observed variant
                      AAfDLSfF Nef(83-90) observed variant
                      AAVDLSHFL Nef(83-91) A*02 human epitope
                      gAfDLSfFL Nef(83-91) observed variant
                      gvfDLSfFL Nef(83-91) observed variant
                      ggfDLSfFL Nef(83-91) observed variant
                      AAfDLSfFL Nef(83-91) observed variant
                      AAVDLSHFL Nef(83-91) A*02 human epitope
                      AAVDiSHFL Nef(83-91) diminished response
                      AAVDirHFL Nef(83-91) inferred escape
                      gAlDLSHFL Nef(83-91) diminished response; escape documented in this paper
                      gArDLSHFL Nef(83-91) escape documented in this paper
                      gAfDLSfFL Nef(83-91) escape documented in this paper
                      AAlDLSHFL Nef(83-91) escape documented in this paper
                      AAiDLSHFL Nef(83-91) escape documented in this paper
                      AAlDiSHFL Nef(83-91) diminished response
                      AAlDiSHlL Nef(83-91) inferred escape
                      kAlDLSHFL Nef(83-91) inferred escape
                      gAVDLSHFL Nef(83-91) escape documented in this paper
                      AAVDLSHFL Nef(83-91) A*02 human epitope
                      AAVDLSHFL Nef(83-91) A*02 human epitope
                      AAVDmSHFL Nef(83-91) diminished response; literature escape
                      gAlDLSHFL Nef(83-91) observed variant
                      AAVDLSHFL Nef(83-91) A*02 human epitope
                      AAVDLSHFL Nef(83-91) A*02 human epitope
                      AALDLSHFL Nef(83-91) A*02:01 mouse epitope
                      GAFDLSFFL Nef(83-91) A*02:05 human epitope
                      GAFDLSFFL Nef(83-91) A*02:05 human epitope
                      GAFDLSFFL Nef(83-91) A*02:05 human epitope
                      GAFDLSFFL Nef(83-91) A*02:05 human epitope
                      GAFDLSFFL? Nef(83-91) A*02:05 human epitope
                      GALDLSHFL Nef(83-91) A*02:06 human epitope
                      GAfDLSfFL Nef(83-91) subtype-specific susceptible form
                      aAvDLSHFL Nef(83-91) observed variant; subtype-specific susceptible form
                      GAFDLSFFL Nef(83-91) A*02:06 human epitope
                      GalDLShFL Nef(83-91) subtype-specific susceptible form
                      GAFDLSFFL Nef(83-91) A*03 human epitope
                      AAVDLSHFL Nef(83-91) A2 human epitope
                      AAVDLSHFL Nef(83-91) A2 human epitope
                      gAfDLSHFL Nef(83-91) observed variant
                      eAVDLSHFL Nef(83-91) observed variant
                      gAiDLSHFL Nef(83-91) observed variant
                      gAlDLSHFL Nef(83-91) observed variant
                      AAlDLSHFL Nef(83-91) observed variant
                      AAVDLSHFL Nef(83-91) A2 human epitope
                      AALDLSHFL Nef(83-91) A2 human, humanized mouse epitope
                      AAVDLSHFL Nef(83-91) A2 human epitope
                      GALDLSHFL Nef(83-91) A2 human epitope
                      aAvDLSHFL Nef(83-91) susceptible form; subtype-specific susceptible form
                      AAVDLSHFL Nef(83-91) A68 human epitope
                      AAVDLSHFL Nef(83-91) B*07 human epitope
                      AAVDLSHFL Nef(83-91) B*14 human epitope
                      AAVDLSHFL Nef(83-91) B*14 human epitope
                      GAFDLSFFL Nef(83-91) B*15:17 human epitope
                      AAVDLSHFL Nef(83-91) B*35:02, B*35:03, B*53:01 human epitope
                      GAFDLSFFL Nef(83-91) B*42:02 human epitope
                      AAFDLSFFL Nef(83-91) B*57:03 human epitope
                      AAFDLSFFL Nef(83-91) B*57:03 human epitope
                      AAVDLSHFL Nef(83-91) B*58 human epitope
                      AAVDLSHFL Nef(83-91) B*58 human epitope
                      AAVDLSHFL Nef(83-91) B*58:01 human epitope
                      AAVDLSHFL Nef(83-91) B60, B62, C*08:02, Cw8 human epitope
                      AAVDLSHFL Nef(83-91) B62, Cw8 human epitope
                      gAVDLSHFL Nef(83-91) susceptible form
                      AAiDLSHFL Nef(83-91) susceptible form
                      AAlDLSHFL Nef(83-91) diminished response; susceptible form
                      gAlDLSHFL Nef(83-91) diminished response
                      gAfDLSHFL Nef(83-91) diminished response; non-susceptible form
                      AAVDLSHFL Nef(83-91) B*81 human epitope
                      AALDLSHFL Nef(83-91) C*03 human epitope
                      AAVDLSHFL Nef(83-91) C*03 human epitope
                      GAFDLSFFL Nef(83-91) C*03 human epitope
                      AAVDLSHFL Nef(83-91) C*03 human epitope
                      AAVDLSHFL Nef(83-91) C*03 human epitope
                      AAFDLSFFL Nef(83-91) C*06:02 human epitope
                      GAFDLSFFL Nef(83-91) C*08 human epitope
                      AAVDLSHFL Nef(83-91) C*08 human epitope
                      AAiDLSHFL Nef(83-91) susceptible form
                      gAVDLSHFL Nef(83-91) susceptible form
                      AAlDLSHFL Nef(83-91) non-susceptible form; susceptible form
                      gAlDLSHFL Nef(83-91) non-susceptible form; susceptible form
                      gAfDLSHFL Nef(83-91) non-susceptible form; susceptible form
                      AAVDLSHFL Nef(83-91) C*08 human epitope
                      GALDLSHFL Nef(83-91) C*08:02 human epitope
                      GAFDLSHFL Nef(83-91) C*08:02 human epitope
                      AAVDLSHFL Nef(83-91) C*08:02 human epitope
                      AAVDLSHFL Nef(83-91) C*17 human epitope
                      AALDLSHFL Nef(83-91) Cw3 human epitope
                      AALDLSHFL Nef(83-91) Cw3 human epitope
                      AALDMSHFL Nef(83-91) Cw3 human epitope
                      AALDiSHFL Nef(83-91) susceptible form
                      gALDMSHFL Nef(83-91) diminished response
                      AAVDLSHFL Nef(83-91) Cw8 human epitope
                      GALDLSFFL Nef(83-91) human epitope
                      GAfDLSFFL Nef(83-91) observed variant
                      AAVDLSHFL Nef(83-91) human epitope
                      GAVDLSHFL Nef(83-91) human epitope
                      GAFDLSFFLK Nef(83-92) A*11 human epitope
                      AAVDLSHFLK Nef(83-92) A11 human epitope
                      vAlDLSHFLK Nef(83-92) susceptible form
                      GAFDLSFFLK Nef(83-92) A11 human epitope
                      AAVDLSHFLK Nef(83-92) A11 human epitope
                      AAVDLSHFLK Nef(83-92) A*11:01 human epitope
                      AAVDLSHFLKEK Nef(83-94) A11 human epitope
                      GALDLSHFLKEKGGL Nef(83-97) A3 human epitope
                       ALDLSHFL Nef(84-91) A2 human epitope
                       AVDLSHFL Nef(84-91) A2 human epitope
                       AVDLSHFL Nef(84-91) B62 human epitope
                       AVDLSHFL Nef(84-91) B62 human epitope
                       AVDLSHFL Nef(84-91) B62 human epitope
                       AfDLSHFL Nef(84-91) observed variant
                       AiDLSHFL Nef(84-91) observed variant
                       AlDLSHFL Nef(84-91) observed variant
                       AVDLSHFLK Nef(84-92) A*03 human epitope
                       AmDLSHFLK Nef(84-92) observed variant
                       AVDLSHFLK Nef(84-92) A*03 human epitope
                       AVDLSHFLK Nef(84-92) A*03, A*11 human epitope
                       AVDLSHFLK Nef(84-92) A*03, A*11 human epitope
                       ALDLSHFLR Nef(84-92) A*03:01 human epitope
                       AvDLSHFLk Nef(84-92) non-susceptible form; susceptible form
                       ALDLSHFLk Nef(84-92) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                       AVDLSHFLK Nef(84-92) A*03:01 human epitope
                       AlDLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       AlDLSHFLr Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       AlDiSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       AlnLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       AlDmSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       AVDLSHFLK Nef(84-92) A*03:01 human epitope
                       AVDLSHFLK Nef(84-92) A*03:01 human epitope
                       AVDLSHFLK Nef(84-92) A*03:01, A*11:01 human epitope
                       AVDLSHFLK Nef(84-92) A*11 human epitope
                       AVDLSHFLK Nef(84-92) A*11 human epitope
                       AVDLSHFLK Nef(84-92) A*11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human, macaque epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AfDLSHFLr Nef(84-92) diminished HLA binding or increased off-rate
                       ArDLSHFLK Nef(84-92) diminished HLA binding or increased off-rate
                       AlDLSHFLK Nef(84-92) susceptible form
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11 human epitope
                       AVDLSHFLK Nef(84-92) A11, A3 human epitope
                       AVDLSHFLK Nef(84-92) A11, A3 human epitope
                       AVDLSHFLK Nef(84-92) A11, A3 human epitope
                       AlDLSHFLK Nef(84-92) observed variant
                       AfDLSHFLK Nef(84-92) diminished HLA binding or increased off-rate
                       AiDLSHFLK Nef(84-92) observed variant
                       AVDLSHFLK Nef(84-92) A11, A3 human epitope
                       AVDLSHFLK Nef(84-92) A11, A3 human epitope
                       AVDLSHFLK Nef(84-92) A11, Cw8 human epitope
                       AVDLSHFLK Nef(84-92) A*11:01 human epitope
                       AVDLSHFLK Nef(84-92) A*11:01 human epitope
                       AVDLSHFLK Nef(84-92) A*11:01 human epitope
                       AVDLSHFLK Nef(84-92) A*11:01 human epitope
                       AfDLSfFLK Nef(84-92) diminished HLA binding or increased off-rate; subtype-specific non-susceptible form
                       AVDLSHFLK Nef(84-92) A*11:01 human epitope
                       ALDLSHFLK Nef(84-92) A*11:01 human epitope
                       AvDLSHFLK Nef(84-92) non-susceptible form
                       ALDLSHFLr Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       ALDiSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       ALnLSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       ALDmSHFLK Nef(84-92) diminished response; escape documented in this paper; non-susceptible form
                       ALDLSHFLK Nef(84-92) A*11:01 human epitope
                       ALDLSHFLr Nef(84-92) escape documented in this paper
                       AVDLSHFLK Nef(84-92) A*11:01 human epitope
                       AVDLSHFLr Nef(84-92) escape documented in this paper
                       AVDLSHFLK Nef(84-92) A3 human epitope
                       AVDLSHFLK Nef(84-92) A3 human epitope
                       AVDLSHFLK Nef(84-92) A3 human epitope
                       AVDLSHFLK Nef(84-92) B*15:03 human epitope
                       AVDLSHFLK Nef(84-92) B*15:17 human epitope
                       AVDLSHFLK Nef(84-92) C*08 human epitope
                       AFDLSFFLK Nef(84-92) human epitope
                       AVDLSHFLK Nef(84-92) human epitope
                       AVDLSHFLK Nef(84-92) human epitope
                       AVDLSHFLK Nef(84-92) human epitope
                       AlDLSHFLK Nef(84-92) non-susceptible form; susceptible form
                       AVDLgHFLK Nef(84-92) non-susceptible form; susceptible form
                       AVDLaHFLK Nef(84-92) non-susceptible form; susceptible form
                       AVDLSfFLK Nef(84-92) non-susceptible form
                       AVDLSaFLK Nef(84-92) non-susceptible form
                       AVDaSHFLK Nef(84-92) non-susceptible form; susceptible form
                       AfDLSfFLK Nef(84-92) non-susceptible form; susceptible form
                       AVNLSHFLK Nef(84-92) human epitope
                       AVdLSHFLK Nef(84-92) susceptible form
                       AVDLSHFLK Nef(84-92) human epitope
                       AVnLSHFLK Nef(84-92) susceptible form
                       AVDLSHFLK Nef(84-92) human epitope
                       AlDLSHFLK Nef(84-92) subtype-specific susceptible form
                       AfDLSfFLK Nef(84-92) subtype-specific susceptible form
                       ALDLSHFLK Nef(84-92) human epitope
                       ALDLSHFLK Nef(84-92) human epitope
                       AvDLSHFLK Nef(84-92) observed variant
                        VDLSHFLK Nef(85-92) A*11:01 human epitope
                        VDLSHFLKEKGGLEGL Nef(85-100) A*02:01 human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health