HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

WLRAQEEEEEVGFPVRPQV Nef(57-74) C*06 human epitope
WLEAQEEEEVGFPVRPQV Nef(57-74) human epitope
WLEAQEEDSDVGFPVRPQV Nef(57-74) human epitope
WLEAQEEDSeVGFPVRPQV Nef(57-74) observed variant
WLEAQEEEEVGFPVRPQV Nef(57-74) human epitope
    QEEEEVGFPVRPQVP Nef(61-75) B57 human epitope
    QEEEEVGFPVRPQVP Nef(61-75) human epitope
    QEEEEVGFPVRPQVPLRPMT Nef(61-80) human epitope
     EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
     EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
     EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
     EEEEVGFVTPQVPLRPMTY Nef(62-81) human epitope
      EEGVGFPVRPQ Nef(63-73) B*45:01 human epitope
      EEEVGFPVKPQVPLR Nef(63-77) B7 human epitope
      EEEVGFPVRPQVPLR Nef(63-77) human epitope
      EEEVGFPVRPQVPLR Nef(63-77) human epitope
       GEVGFPVRPQV Nef(64-74) B45 human epitope
       EEVGFPVKPQV Nef(64-74) B*45:01 human epitope
       dEVGFPVKPQV Nef(64-74) diminished response; escape documented in this paper
       dEVGFPVrPQV Nef(64-74) diminished response; escape documented in this paper
       gEVGFPVrPQV Nef(64-74) susceptible form
       EEVGFPVRPQV Nef(64-74) B*45:01 human epitope
       EEVGFPVRPQV Nef(64-74) B*45:01 human epitope
       EEVGFPVKPQV Nef(64-74) human epitope
       EEVGFPVRPQV Nef(64-74) human epitope
       EEVGFPVRPQV Nef(64-74) human epitope
        EVGFPVRPQVPL Nef(65-76) human epitope
        EVGFPiRPQVPL Nef(65-76) observed variant
        gVGFPVRPQVPL Nef(65-76) observed variant
        EmGFPVRPQVPL Nef(65-76) observed variant
        kVGFPVRPQVPL Nef(65-76) observed variant
        EVGFPVRPQVPLRPM Nef(65-79) human epitope
        EVGFPVRPQVPLRPM Nef(65-79) human epitope
        EVGFPVRPQVPLRPMTFK Nef(65-82) C*03, C*04, C*12 human epitope
        EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
        EVGFPVRPQVPLRPMTfK Nef(65-82) subtype-specific susceptible form
        DVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
        eVGFPVRPQVPLRPMTYK Nef(65-82) observed variant
        EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
        EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
        EVGFPVtPQVPLRPMTYK Nef(65-82) observed variant
        EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
         VGFPVRPQV Nef(66-74) A*02:01 human epitope
         VGFPVRPQV Nef(66-74) human epitope
         VGFPVTPQVPLRMT Nef(66-80) A1, B8 human epitope
         VGFPVTPQVPLRMT Nef(66-80) A1, B8 human epitope
         VGFPVTPQVPLRPMTYK Nef(66-82) A*11:01 human epitope
         VGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGL Nef(66-97) human epitope
          GFPVRPQVPLRPMTY Nef(67-81) human epitope
          GFPVRPQVPLRPMTY Nef(67-81) human epitope
          GFPVRPQVPLRPMTY Nef(67-81) human epitope
           FPVTPQVPL Nef(68-76) A*68:02 human epitope
           FPVTPQVPL Nef(68-76) B*07 human epitope
           FPVTPQVPL Nef(68-76) B*07 human epitope
           FPVTPQVPL Nef(68-76) B*07 human epitope
           FPVTPQVPL Nef(68-76) B*07 human, transgenic mouse epitope
           FPVKPQVPL Nef(68-76) B*07:02 human epitope
           FPVTPQVPL Nef(68-76) B*07:02 human epitope
           FPVKPQVPL Nef(68-76) B*07:02 human epitope
           FPVrPQVPL Nef(68-76) non-susceptible form; susceptible form
           FPVtPQVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form; susceptible form
           FPVRPQVPL Nef(68-76) B*07:02 human epitope
           FPVkPQVPL Nef(68-76) inferred escape; literature escape
           FPVRPQVPL Nef(68-76) B*07:02 human epitope
           FPVRPQVPL Nef(68-76) B*07:02 human epitope
           FSVRPQVPL Nef(68-76) susceptible form
           FPARPQVPL Nef(68-76) susceptible form
           SPVRPQVPL Nef(68-76) susceptible form
           FPIRPQVPL Nef(68-76) observed variant
           FPVRPQVPL Nef(68-76) B*07:02 human epitope
           FPVkPQVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
           FPVkPQVPv Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
           FPVkPrVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
           FPVkPQVsL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
           FPVtPQVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
           FPVtPQVPv Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
           FPVtPrVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
           FPVRPQVPL Nef(68-76) B*07:02 human epitope
           FPVRPQVPL Nef(68-76) B*07:02 human epitope
           FPVRPQVPL Nef(68-76) B*35 human epitope
           FPVRPQVPL Nef(68-76) B*35 human epitope
           FPVkPQVPL Nef(68-76) susceptible form
           FPVTPQVPL Nef(68-76) B*35 human epitope
           FPVTPQVPL Nef(68-76) B35 human epitope
           FPVRPQVPL Nef(68-76) B35 human epitope
           FPVRPQVPL Nef(68-76) B35 human epitope
           FPVRPQVPL Nef(68-76) B35 human epitope
           FPVKPQVPL Nef(68-76) B35, B7 human epitope
           FPVKPQVPL Nef(68-76) B35, B7 human epitope
           FPVRPQVPL Nef(68-76) B*35:01 human epitope
           FPVRPQVPL Nef(68-76) B*35:01 human epitope
           FPVRPQVPL Nef(68-76) B*35:01 human epitope
           FPVRPQVPL Nef(68-76) B*35:01, B7 human epitope
           FPVTPQVPL Nef(68-76) B7 human epitope
           FPVRPQVPL Nef(68-76) B7 human epitope
           FPVRPQVPL Nef(68-76) B7 human epitope
           FPVRPQVPL Nef(68-76) B7 human epitope
           FPVtPQVPL Nef(68-76) observed variant
           FPVTPQVPL Nef(68-76) B7 human epitope
           FPVTPQVPL Nef(68-76) B7 supertype human epitope
           FPVRPQVPL Nef(68-76) B7 supertype human, mouse epitope
           FPVRPQVPL Nef(68-76) human epitope
           FPVtPQVPL Nef(68-76) escape documented in this paper
           FPVkPQVPL Nef(68-76) diminished response
           FPVKPQVPL Nef(68-76) human epitope
           FPVrPQVPL Nef(68-76) susceptible form
           FPVTPQVPLR Nef(68-77) A*68:02 human epitope
           FPVTPQVPLR Nef(68-77) B*07 human epitope
           FPVTPQVPLR Nef(68-77) B*07 human, transgenic mouse epitope
           FPVrPQVPLR Nef(68-77) non-susceptible form
           FPVTPQVPLR Nef(68-77) B*07 human epitope
           FPVTPQVPLR Nef(68-77) B*07, B*35 human epitope
           FPVRPQVPLR Nef(68-77) B*07:02 human epitope
           FPVkPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
           FPVkPQVPvR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
           FPVkPQePLi Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
           FPVtPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
           FPVtPQVPLt Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
           FPVTPQVPLR Nef(68-77) B*07:02 human epitope
           FPVTPQVPLR Nef(68-77) B*07:02 human epitope
           FPVKPQVPLR Nef(68-77) B*07:02 human epitope
           FPVrPQVPLR Nef(68-77) non-susceptible form
           FPVtPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
           FPVRPQVPLR Nef(68-77) B7 human epitope
           FPVRPQVPLR Nef(68-77) B7 human epitope
           FPVtPQVPLR Nef(68-77) observed variant
           FPVRPQVPLR Nef(68-77) B7 human epitope
           FPVTPQVPLR Nef(68-77) B7 human epitope
           FPVTPQVPLR Nef(68-77) B7 human epitope
           FPVTPQVPLR Nef(68-77) B7 human epitope
           FPVTPQVPLR Nef(68-77) B7 human epitope
           FPVTPQVPLR Nef(68-77) B7 human epitope
           FPVTPQVPLR Nef(68-77) B7 human epitope
           FPVTPQVPLR Nef(68-77) B*81 human epitope
           FPVTPQVPLR Nef(68-77) human epitope
           FPVRPQVPLR Nef(68-77) human epitope
           FPVkPQVPLR Nef(68-77) altered HLA expression
           FPVTPQVPLR Nef(68-77) human epitope
           FPVTPQVPLRMTY Nef(68-81) human epitope
           FPVrPQVPLRMTY Nef(68-81) observed variant
           FPVkPQVPLRMTY Nef(68-81) observed variant
           FPVTPQVPLRPMTFK Nef(68-82) A3 human epitope
           FPVRPQVPLRPMTYK Nef(68-82) A3 human epitope
           FPVRPQVPLRPMTYK Nef(68-82) B35 human epitope
           FPVRPOVPLRPMTYK Nef(68-82) human epitope
           FPVRPQVPLRPMTYKGA Nef(68-84) human epitope
           FPVRPQVPLRPMTYKaA Nef(68-84) observed variant
            PVKPQVPLR Nef(69-77) human epitope
            PVRPQVPLRPMTYKA Nef(69-83) human epitope
            PVRPQVPLRPMTfKA Nef(69-83) observed variant
             VTPQVPLRPMTYKAA Nef(70-84) human epitope
              TPQVPLRPM Nef(71-79) A*30 human epitope
              TPQVPLRPM Nef(71-79) A*34 human epitope
              TPQVPLRPM Nef(71-79) A*68:02 human epitope
              RPQVPLRPM Nef(71-79) B*07 human epitope
              TPQVPLRPM Nef(71-79) B*07 human epitope
              TPQVPLRPM Nef(71-79) B*07 human epitope
              RPQVPLRPM Nef(71-79) B*07, B*81:01 human epitope
              RPQVPLRPM Nef(71-79) B*07:02 human epitope
              kPQVPLRPM Nef(71-79) inferred escape
              TPQVPLRPM Nef(71-79) B*07:02 human epitope
              RPQVPLRPM Nef(71-79) B*07:02 human epitope
              RPQVPLRPM Nef(71-79) B*07:02, B*42:01, B*81:01, B7, B81 human epitope
              RPQVPLRPM Nef(71-79) B*07:02, B*81:01 human epitope
              RPQVPLRPM Nef(71-79) B*07:02, B*81:01 human epitope
              RPQVPvRPM Nef(71-79) altered HLA expression; observed variant; replicative capacity reduced
              TPQVPLRPM Nef(71-79) B*35 human epitope
              TPQVPLRPM Nef(71-79) B35 human epitope
              RPQVPLRPM Nef(71-79) B*35:01 human epitope
              RPQVPLRPM Nef(71-79) B*35:02, B*35:03, B*53:01 human epitope
              RPQVPLRPM Nef(71-79) B*39 human epitope
              RPQVPLRPM Nef(71-79) B*42 human epitope
              RPQVPLRPM Nef(71-79) B*42 human epitope
              RPQVPLRPM Nef(71-79) B42 human epitope
              TPQVPLRPM Nef(71-79) B42 human epitope
              RPQVPLRPM Nef(71-79) B*42:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:01, B*42:02 human epitope
              RPQQVPLRPM Nef(71-79) B*42:01, B*81:01 human epitope
              RPQVPLRPM Nef(71-79) B*42:02 epitope
              RPQVPLRPM Nef(71-79) B*42:02 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              RPQVPLRPM Nef(71-79) B7 human epitope
              tPQVPLRPM Nef(71-79) observed variant
              TPQVPLRPM Nef(71-79) B7 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              TPQVPLRPM Nef(71-79) B7 human epitope
              RPQVPLRPM Nef(71-79) B*78 human epitope
              TPQVPLRPM Nef(71-79) B*78 human epitope
              TPQVPLRPM Nef(71-79) B7 supertype human epitope
              RPQVPLRPM Nef(71-79) B*81 human epitope
              RPQVPLRPM? Nef(71-79) B81 human epitope
              RPQVPLRPM Nef(71-79) B*81:01 human epitope
              RPQVPvRPM Nef(71-79) calculated escape
              RPQVPtRPM Nef(71-79) observed variant
              RPQVPmRPM Nef(71-79) observed variant
              RPQmPLRPM Nef(71-79) observed variant
              kPQVPvRPM Nef(71-79) observed variant
              RPQVPiRPM Nef(71-79) observed variant
              tPQVPIRPM Nef(71-79) observed variant
              RPQVPLRPM Nef(71-79) B*81:01 human epitope
              RPQVPLRPM Nef(71-79) B*81:01 human epitope
              RPQVPvRPM Nef(71-79) literature escape
              RPQaPLRPM Nef(71-79) observed variant
              kPQVPLRPM Nef(71-79) observed variant
              RPQVPiRPM Nef(71-79) literature escape
              RPQVPtRPM Nef(71-79) literature escape
              RPQVPLRPM Nef(71-79) B*82 human epitope
              RPQVPLRPM Nef(71-79) C*04 human epitope
              RPQVPLRPM Nef(71-79) C*17 human epitope
              RPQVPLRPM Nef(71-79) human epitope
              kPQVPLRPM Nef(71-79) susceptible form
              tPQVPLRPM Nef(71-79) observed variant
              RPQVPvRPM Nef(71-79) escape documented in this paper
              RPQVPtRPM Nef(71-79) escape documented in this paper
              tPQVPLkPM Nef(71-79) observed variant
              RPQaPLRPM Nef(71-79) observed variant
              RPQVPmRPM Nef(71-79) observed variant
              kPQVPvRPM Nef(71-79) observed variant
              RPQmPLRPM Nef(71-79) observed variant
              RPQVPiRPM Nef(71-79) escape documented in this paper
              cPQVPLRPM Nef(71-79) observed variant
              RPQVrLRPM Nef(71-79) observed variant
              RPQVlLRPM Nef(71-79) observed variant
              RPQVPLRPM Nef(71-79) human epitope
              TPQVPLRPMTY Nef(71-81) B*07, B*35 human epitope
              RPQVPLRPMTY Nef(71-81) B*35 human epitope
              RPQVPLRPMTf Nef(71-81) susceptible form
              tPQVPLRPMTY Nef(71-81) escape documented in this paper
              tPQVPLRPMTf Nef(71-81) observed variant
              RPQVPLRPMTY Nef(71-81) B*35 human epitope
              tPQVPLRPMTY Nef(71-81) diminished response
              RPQVPLRPMTY Nef(71-81) B*35 human epitope
              RPQVPLRPMTY Nef(71-81) B35 human epitope
              RPQVPLRPMTY Nef(71-81) B35 human epitope
              TPQVPLRPMTY Nef(71-81) B35 human epitope
              RPQVPLRPMTY Nef(71-81) B35 human epitope
              tPQVPLRPMTY Nef(71-81) escape documented in this paper; TCR related mutation
              RPQVPLRPMTY Nef(71-81) B35 human epitope
              kPQVPLRPMTY Nef(71-81) altered HLA expression; observed variant; replicative capacity reduced
              RPQVPLRPMTY Nef(71-81) B35 human epitope
              RPQVPLRPMTf Nef(71-81) susceptible form
              RPQVPLRPMTY Nef(71-81) B35 human epitope
              RPQVPLRPMTY Nef(71-81) B35 human epitope
              tPQVPLRPMTY Nef(71-81) escape documented in this paper
              tPQVPLRPMTf Nef(71-81) escape documented in this paper
              RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
              RPQVPLRPMTf Nef(71-81) observed variant; replicative capacity is not abrogated
              kPQVPLRPMTY Nef(71-81) observed variant; replicative capacity is not abrogated
              RPQVPLRPMdY Nef(71-81) observed variant; replicative capacity is not abrogated
              RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
              RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
              RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
              tPQVPLRPMTY Nef(71-81) escape documented in this paper
              tPQVPLRPMTf Nef(71-81) escape documented in this paper
              RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
              RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
              RPQVPLRPMTY Nef(71-81) B51 human, macaque epitope
              TPQVPLRPMTY Nef(71-81) B7 human epitope
              TPQVPLRPMTY Nef(71-81) B7 supertype human epitope
              rPQVPLRPMTY Nef(71-81) susceptible form
              RPQVPLRPMTY Nef(71-81) human epitope
              RPQVPLRaMTY Nef(71-81) HLA association
              KPQVPLRPMTYKAAV Nef(71-85) A3, B35 human epitope
              RPQVPLRPMTYKAAL Nef(71-85) human epitope
              RPQVPLRPMTYKAAL Nef(71-85) human epitope
              RPQVPLRPMTYKAAL Nef(71-85) human epitope
              RPQVPLRPMTYKAAVDLSHF Nef(71-90) human epitope
               PQVPLRPMTY Nef(72-81) B35 human epitope
               PQVPLRPMTY Nef(72-81) B35, B51 human epitope
               PQVPLRPMTY Nef(72-81) B*51 human epitope
               PQVPLRPMTYKGAFD Nef(72-86) human epitope
               PQVPLRPMTYKAAVDLSHFL Nef(72-91) human epitope
               PQVPLRRMTYKAAVDLSHFL Nef(72-91) human epitope
               PQVPLRMTYKAAVDLSHFL Nef(72-91) human epitope
                QVPLRPMTY Nef(73-81) A1 human epitope
                QVPLRPMTY Nef(73-81) A*80:01 human epitope
                QVPLRPMTY Nef(73-81) B*07 human epitope
                QVPLRPMTY Nef(73-81) B*35 human epitope
                QVPLRPMTY Nef(73-81) B*35:01 human epitope
                QVPLRPMTY Nef(73-81) human epitope
                QVPvRPMTY Nef(73-81) susceptible form
                QaPLRPMTY Nef(73-81) non-susceptible form; susceptible form
                QVPLRPMTf Nef(73-81) non-susceptible form; susceptible form
                QVPaRPMTY Nef(73-81) non-susceptible form; susceptible form
                QVPLRaMTY Nef(73-81) non-susceptible form; susceptible form
                QVPLaPMTY Nef(73-81) non-susceptible form; susceptible form
                QVPLRPMTYK Nef(73-82) A*02:01 human epitope
                QVPLRPMTYK Nef(73-82) A*02:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03 human epitope
                QVPLRPMTYK Nef(73-82) A*03 human epitope
                QVPLRPMTYK Nef(73-82) A*03 human epitope
                QVPLRPMTYK Nef(73-82) A*03 human epitope
                QVPLRPMTYK Nef(73-82) A*03 human epitope
                QVPLRPMTYK Nef(73-82) A*03 human epitope
                QVPLRPMTYK Nef(73-82) A*03, A*11, A*31, B*27, B*35 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTeK Nef(73-82) diminished response
                QVPvRPMTYK Nef(73-82) diminished response
                QVPiRPMTYK Nef(73-82) diminished response
                QVPLRPMTYq Nef(73-82) diminished response
                QVPLRPMTrr Nef(73-82) non-susceptible form
                QVPLRPMTYr Nef(73-82) non-susceptible form; susceptible form
                hVPLRPMTYK Nef(73-82) diminished response; susceptible form
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QiPLRPMTYK Nef(73-82) susceptible form
                QVPLaPMTYK Nef(73-82) diminished response
                QVPLgPMTYK Nef(73-82) diminished response
                QVPLgPMsYK Nef(73-82) susceptible form
                QVPLRPMaYK Nef(73-82) diminished response
                QVPLRPaTYK Nef(73-82) diminished response
                aVPLRPMTYK Nef(73-82) susceptible form
                QaPLRPMTYK Nef(73-82) susceptible form
                QVaLRPMTYK Nef(73-82) susceptible form
                QVPaRPMTYK Nef(73-82) susceptible form
                QVPLRaMTYK Nef(73-82) susceptible form
                QVPLRPMTaK Nef(73-82) susceptible form
                QVPLRPMTYa Nef(73-82) susceptible form
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                QVPLRPMTYK{gA} Nef(73-82) inferred escape
                QVPLRPMTfK{gA} Nef(73-82) inferred escape
                QVPLRPMTYK Nef(73-82) A*03:01, A*11 human epitope
                QiPLRPMTYK Nef(73-82) diminished HLA binding or increased off-rate; observed variant
                QVPLRPMTYK Nef(73-82) A*03:01, A11 human, macaque epitope
                QVPLRPMTYK Nef(73-82) A*03:01, A11 human epitope
                QVPLRPMTYK Nef(73-82) A03 supertype human epitope
                QVPLRPMTYK Nef(73-82) A*11 human epitope
                QVPLRPMTYK Nef(73-82) A*11 human epitope
                QVPLRPMTYK Nef(73-82) A*11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTsr Nef(73-82) diminished HLA binding or increased off-rate
                {r*}QVPLRPMTYK{g} Nef(73-82) inferred escape; processing
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11 human epitope
                QVPLRPMTYK Nef(73-82) A11, A2, A3, B35 human epitope
                QVPLRPMYTK Nef(73-82) A11, A3 human epitope
                QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                QVPvRPMTYK Nef(73-82) observed variant
                QVPmRPMTYK Nef(73-82) observed variant
                QVPLRPMTfK Nef(73-82) susceptible form
                QVPLRPMTYK Nef(73-82) A11, A3, A30 epitope
                QVPLRPMTYK Nef(73-82) A11, A3, B35 human epitope
                QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                QVPLRPMTYK Nef(73-82) A*11:01 epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTfK Nef(73-82) susceptible form
                QVPLkPMTfK Nef(73-82) diminished response
                QVPLRPMnYK Nef(73-82) diminished response
                QVPvRPMTfK Nef(73-82) escape documented in this paper
                QVPLRPMsYr Nef(73-82) escape documented in this paper
                QVPLRPMsYK Nef(73-82) susceptible form
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRRMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRRMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                QVPLRPMTYK Nef(73-82) A3 human epitope
                {k*}QVPLRPMTYK{g} Nef(73-82) escape documented in this paper; processing
                QVPLRPMTYK Nef(73-82) A*33 human epitope
                QVPLRPMTYK Nef(73-82) A*34 human epitope
                QVPLRPMTYK Nef(73-82) A3 supertype human epitope
                QVPLRPMTYK Nef(73-82) A*66 human epitope
                QVPLRPMTYK Nef(73-82) B*08 human epitope
                QVPLRPMTYK Nef(73-82) B27 human epitope
                SVPLRPMTYK Nef(73-82) B35, Cw4 human epitope
                QVPLRPMTYK Nef(73-82) B*35:02, B*35:03, B*53:01 human epitope
                QVPLRPMTYK Nef(73-82) B8 human epitope
                SVPLRPMTYK Nef(73-82) C*04 human epitope
                QVPVRPMTYK Nef(73-82) C*08 human epitope
                QVPLRPMTYK Nef(73-82) human epitope
                QVPLRPMTYK Nef(73-82) human epitope
                QVPLRPMTYK Nef(73-82) human epitope
                QVPLRPMTYK Nef(73-82) human epitope
                QVPLRPMTYK Nef(73-82) human epitope
                QVPLRPMTYKA Nef(73-83) A3 human epitope
                QVPLRPMTYKAAVDL Nef(73-87) B57 human epitope
                QVPLRPMTYKAAVDL Nef(73-87) human epitope
                QVPLRPMTfKAAVDL Nef(73-87) observed variant
                QVPLRPMTYKAAVDL Nef(73-87) human epitope
                AVPLRPMTYKAAFDLSFF Nef(73-90) A*68:02 human epitope
                QVPLRPMTYKGALDLSHF Nef(73-90) human epitope
                QVPLRPMTYKAAVDLSHF Nef(73-90) human epitope
                QVPLRPMTYKAAFDLSFFLKEKG Nef(73-95) human epitope
                 VPLRPMTY Nef(74-81) A*11 human epitope
                 VPLRPMTY Nef(74-81) A3 human epitope
                 VPLRPMTY Nef(74-81) B*07 human epitope
                 VPLRPMTY Nef(74-81) B*35 human epitope
                 VPLRPMTY Nef(74-81) B*35 human epitope
                 VPLRPMTY Nef(74-81) B*35 human epitope
                 VPLRPMTf Nef(74-81) literature escape
                 VPLRPMTY Nef(74-81) B*35 epitope
                 VPLRPMTY Nef(74-81) B*35 human epitope
                 VPLRPMTY Nef(74-81) B*35 human epitope
                 VPLRPMTY Nef(74-81) B*35, B*53 human epitope
                 VPLRPMTf Nef(74-81) escape documented in this paper
                 lPLRPMTY Nef(74-81) observed variant
                 VPLRPiTY Nef(74-81) observed variant
                 VPLRPMTt Nef(74-81) observed variant
                 VPLRPMnY Nef(74-81) observed variant
                 VPLRPMTY Nef(74-81) B*35, B*53:01 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTf Nef(74-81) escape documented in this paper
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMsY Nef(74-81) escape documented in this paper
                 VPLRPMTf Nef(74-81) escape documented in this paper
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35 human, macaque epitope
                 VPLRPMTY Nef(74-81) B35 human epitope
                 VPLRPMTY Nef(74-81) B35, B42 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTf Nef(74-81) diminished response
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPvRPMTY Nef(74-81) observed variant; susceptible form
                 VPLRPMTf Nef(74-81) diminished response; non-susceptible form; TCR related mutation
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTF Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTY Nef(74-81) B*35:01 human epitope
                 VPLRPMTf Nef(74-81) escape documented in this paper
                 VPLRPMTY Nef(74-81) B*35:02, B*35:03, B*53:01 human epitope
                 VPLRPMTY Nef(74-81) B*55 human epitope
                 VPLRPMTY Nef(74-81) B*78 human epitope
                 VPLRPMTY Nef(74-81) B*81 human epitope
                 VPLRPMTY Nef(74-81) C*12 human epitope
                 VPLRPMTY Nef(74-81) human epitope
                 VPLRPMTY Nef(74-81) human epitope
                 VPLRPMTYK Nef(74-82) A11 human epitope
                 VPLRPMTFK Nef(74-82) human epitope
                 VPLRPMTYKA Nef(74-83) B7 human epitope
                 VPLRPMTYRAARDLS Nef(74-88) B7 supertype human epitope
                 IPLRPMTYKGALDLS Nef(74-88) B7 supertype human epitope
                  PLRPMTYK Nef(75-82) A11 human epitope
                  PLRPMYTK Nef(75-82) A11 human epitope
                  PLRPMTYK Nef(75-82) A*11:01 human epitope
                  PLRPMTYK Nef(75-82) A*11:01 human epitope
                  PLRPMTYK Nef(75-82) B*15:01 human epitope
                  PLRPMTYK Nef(75-82) C*02 human epitope
                  PLRPMTYKAALDLSH Nef(75-89) human epitope
                   LRPMTYKAA Nef(76-84) B*27:03 human epitope
                   LRPMTYKAA Nef(76-84) B*27:03 human epitope
                    RPMTYKAAL Nef(77-85) A*32 human epitope
                    RPMTYKAAL Nef(77-85) B*07 human epitope
                    RPMTYKAAV Nef(77-85) B*07 human epitope
                    RPMTYKAAL Nef(77-85) B*07 human epitope
                    RPMTYKAAL Nef(77-85) B*07 human epitope
                    RPMThqAAw Nef(77-85) diminished response; susceptible form
                    RPMTYKGAL Nef(77-85) B*07 human epitope
                    RPMTYKAAV Nef(77-85) B*07 human epitope
                    RPMTYKAAL Nef(77-85) B*07 human, transgenic mouse epitope
                    RPMTYKgAL Nef(77-85) susceptible form
                    RPMTYKAAv Nef(77-85) susceptible form
                    RPMTfKAAL Nef(77-85) susceptible form
                    RPMTYKfAL Nef(77-85) susceptible form
                    RPMTYKAAf Nef(77-85) susceptible form
                    RPMTYKAAL Nef(77-85) B*07 human epitope
                    RPMTYKAAL Nef(77-85) B*07 human epitope
                    RPMTYKAAL Nef(77-85) B*07:02 human epitope
                    RPMTYKAAL Nef(77-85) B*07:02 human epitope
                    RPMTYKAAV Nef(77-85) B*07:02 human epitope
                    RPMTYKAAf Nef(77-85) subtype-specific susceptible form
                    RPMTYKGAL Nef(77-85) B*07:02 human epitope
                    RPMTfKGAL Nef(77-85) inferred escape; literature escape
                    RPMTFKGAL Nef(77-85) B*07:02 human epitope
                    RPMTYKGAL Nef(77-85) B*07:02 human epitope
                    RPMTYKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                    RPMTYKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                    RPMTYKaAf Nef(77-85) diminished response; escape documented in this paper; susceptible form
                    RPMTYKaAi Nef(77-85) diminished response; escape documented in this paper; susceptible form
                    RPMTfKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTfKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTYKgAv Nef(77-85) diminished response; escape documented in this paper; susceptible form
                    RPMTFKGAL Nef(77-85) B*07:02 human epitope
                    RPMTFKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTFKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTyKaAi Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTyKaAf Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTyKGAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTyKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTyKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                    RPMTyKGAL Nef(77-85) susceptible form
                    RPMTYKAAL Nef(77-85) B*07:02 human epitope
                    RPMTYKAAL Nef(77-85) B*18 human epitope
                    RPMTYKAAV Nef(77-85) B*42:01 human epitope
                    RPMTFKGAF Nef(77-85) B*42:01, B*42:02 human epitope
                    RPMTYKAAV Nef(77-85) B7 human epitope
                    RPMTYKAAV Nef(77-85) B7 human epitope
                    RPMTYKAAL Nef(77-85) B7 human epitope
                    RPMTYKAAV Nef(77-85) B7 human epitope
                    RPMTYKGAL Nef(77-85) B7 human epitope
                    RPMTYKaAv Nef(77-85) observed variant
                    RPMTYKaAL Nef(77-85) observed variant
                    RPMTYKAAL Nef(77-85) B7 human epitope
                    RPMTYKAAL Nef(77-85) B7 human epitope
                    RPMTYKAAV Nef(77-85) B7 human epitope
                    RPMTYKAAV Nef(77-85) B7 human epitope
                    RPMTYKAAl Nef(77-85) observed variant
                    RPMTYKgAi Nef(77-85) non-susceptible form; susceptible form
                    RPMTYKgAl Nef(77-85) observed variant
                    RPMTYKgAf Nef(77-85) observed variant
                    RPMTfKgAf Nef(77-85) observed variant
                    RPMTfKAAV Nef(77-85) observed variant
                    RPMTYKeAV Nef(77-85) observed variant
                    RPMTYKGAL Nef(77-85) B7 human epitope
                    RPMTYKGAL Nef(77-85) B7 human epitope
                    RPMTYrGAL Nef(77-85) observed variant
                    RPMTYKaAL Nef(77-85) observed variant
                    RPMTYKGAv Nef(77-85) observed variant
                    RPMsYKaAL Nef(77-85) observed variant
                    RPMTfKGAL Nef(77-85) observed variant
                    RPMTYKAAV Nef(77-85) B7 human epitope
                    RPMTYKAAL Nef(77-85) B7 human epitope
                    RPMTYKAAL Nef(77-85) B7 human epitope
                    RPMTYKAAL Nef(77-85) B7 human epitope
                    RPMTYKGAL Nef(77-85) B7 supertype human epitope
                    RPMTYraAr Nef(77-85) susceptible form
                    RPMTYKAAL Nef(77-85) B*81 human epitope
                    RPMTYKAAL Nef(77-85) B*82 human epitope
                    RPMTYKAAV Nef(77-85) B*82 human epitope
                    RPMTYKAAV Nef(77-85) C*08 human epitope
                    RPMTYKAAL Nef(77-85) C*17 human epitope
                    RPMTYKAAV Nef(77-85) human epitope
                    RPMTYKAAV Nef(77-85) human epitope
                    RPMTYKGAL Nef(77-85) human epitope
                    RPMTYKAAV Nef(77-85) human epitope
                    RPMTWKGAL Nef(77-85) human epitope
                    RPMTWKAAL Nef(77-85) susceptible form
                    RPMTYKGAL Nef(77-85) susceptible form
                    RPMTRKAAL Nef(77-85) susceptible form
                    RPMTCKGAL Nef(77-85) susceptible form
                    RPMTYKAAL Nef(77-85) observed variant
                    RPITYKAAL Nef(77-85) susceptible form
                    RPMTYKGAVDLSHFL Nef(77-91) B62 human epitope
                    RPMTYKAALDLSHFL Nef(77-91) B62 human epitope
                    RPMTYKGAFDLSFFL Nef(77-91) human epitope
                    RPMTYKAAVDLSHFL Nef(77-91) human epitope
                    RPMTfKAAVDLSHFL Nef(77-91) observed variant
                    RPMTYKAAVDLSHFLK Nef(77-92) A*02:01 human epitope
                     PMTYKAAVDLSHFLK Nef(78-92) A3 human epitope
                     PMTYKGAFDLSHFLK Nef(78-92) B62 human epitope
                     PMTYKAAVDLSHFLK Nef(78-92) B62 human epitope
                      MTYKAALDL Nef(79-87) A*02:01 mouse epitope
                      MTYKAAFDL Nef(79-87) A*02:01 human epitope
                      MTYKAALDL Nef(79-87) A2 human, humanized mouse epitope
                      MTYKAAVDL Nef(79-87) B63 human epitope
                      MTYKGALDL Nef(79-87) human epitope
                      MTYKAALDLSHFLK Nef(79-92) human epitope
                      MTYKGAFDLSHFLKE Nef(79-93) human epitope
                       TYKAAVDL Nef(80-87) A24 human epitope
                       TYKAAVDL Nef(80-87) A24 human epitope
                       TYKgAfDL Nef(80-87) observed variant
                       TfKAAVDL Nef(80-87) observed variant
                       TfKgAfDL Nef(80-87) observed variant
                       TYKeAVDL Nef(80-87) observed variant
                       TYKgAiDL Nef(80-87) observed variant
                       TYKgAlDL Nef(80-87) observed variant
                       TYKAAlDL Nef(80-87) observed variant
                       TYKAAVDLSHFLKEK Nef(80-94) human epitope
                        YKGALDLSHFL Nef(81-91) human epitope
                        YKAAVDLSHFLKEKG Nef(81-95) B57 human epitope
                        YKAAVDLSHFLKEKG Nef(81-95) human epitope
                        FKAALDLSHFLNEKG Nef(81-95) human epitope
                        FKAAvDLSHFLNEKG Nef(81-95) non-susceptible form
                        FKGAFDLSFFLKEKEGGL Nef(81-97) B*42:01 human epitope
                        FKGAFDLSFFLKEKGGL Nef(81-97) C*04 human epitope
                        YKGALDLSHFLKEKGGL Nef(81-97) human epitope
                        fKGAfDLSfFLKEKGGL Nef(81-97) subtype-specific susceptible form
                        YKAAVDLSHFLKEKGGL Nef(81-97) human epitope
                        YKGAVDLSHFLKEKGGLE Nef(81-98) human epitope
                        YKaAVDLSHFLKEKGGLEGL Nef(81-98) observed variant
                        YKaAVDLSHFLKEKGGLE Nef(81-98) observed variant
                        YKGALDLSHFLKEKGGLE Nef(81-98) human epitope
                        YKAAVDLSHFLKEKGGLEGL Nef(81-100) human epitope
                        YKgAVDLSHFLKEKGGLE Nef(81-100) observed variant
                         KAAVDLSHF Nef(82-90) B*57 human epitope
                         KgAVDLSHF Nef(82-90) observed variant
                         KAAlDLSHF Nef(82-90) observed variant
                         KrAlDLSHF Nef(82-90) observed variant
                         KgAlDLSHF Nef(82-90) observed variant
                         agAlnLSHF Nef(82-90) observed variant
                         rgAVDLSHF Nef(82-90) observed variant
                         KAAVDLSHF Nef(82-90) B*57 human epitope
                         KAAVDiSHF Nef(82-90) observed variant
                         KAAVnLSHF Nef(82-90) observed variant
                         KgAlDLSHF Nef(82-90) observed variant
                         KAAVDLSHF Nef(82-90) B*57 human epitope
                         KGAFDLSFF Nef(82-90) B*57 human epitope
                         KAAFDLSFF Nef(82-90) B*57, B*58:01 human epitope
                         KgAFDLSFF Nef(82-90) HLA association; diminished HLA binding or increased off-rate; diminished response; escape documented in this paper
                         KgAFgLSFF Nef(82-90) HLA association; observed variant
                         KAAFgLSFF Nef(82-90) observed variant
                         KgAvDLSFF Nef(82-90) observed variant; susceptible form
                         KAAFDLSFF Nef(82-90) B*57, B*58:01 human epitope
                         KAAVDLSHF Nef(82-90) B*57, B*58:01 human epitope
                         KgAVDLSHF Nef(82-90) diminished HLA binding or increased off-rate; escape documented in this paper; susceptible form
                         KAALDLSHF Nef(82-90) B57 human epitope
                         KAAFDLSFF Nef(82-90) B57 human epitope
                         KAAVDLSHF Nef(82-90) B57 human epitope
                         KSALDLSHF Nef(82-90) B57 human epitope
                         KAAVDLSHF Nef(82-90) B57 human epitope
                         KAAFDLSFF Nef(82-90) B57 human epitope
                         KAAFDLgFF Nef(82-90) diminished response
                         KgAFDLgFF Nef(82-90) susceptible form
                         KAAFDLSFF Nef(82-90) B*58:01, B57 human epitope
                         KGALDLSHF Nef(82-90) B*58:01, B57 human epitope
                         KAALDLSHF Nef(82-90) B*57:01 human epitope
                         KgALDLSHF Nef(82-90) diminished response
                         qAALDLSHF Nef(82-90) diminished response
                         tAALDLSHF Nef(82-90) observed variant
                         pAALDLSHF Nef(82-90) observed variant
                         KAAhDLSHF Nef(82-90) observed variant
                         KAALDiSHF Nef(82-90) observed variant
                         {l*****}qAALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                         {*****}KgALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                         {**}KAALDLSHF Nef(82-90) compensatory mutation; inferred escape; processing
                         KAAFDLSFF Nef(82-90) B*57:01 human epitope
                         KAAFDLSFF Nef(82-90) B*57:01, B*58:01 human epitope
                         KAAFDLSFF Nef(82-90) B*57:02, B*57:03, B*58:01 human epitope
                         KgAFDLSFF Nef(82-90) escape documented in this paper
                         KAAFDLSFF Nef(82-90) B*57:02, B*57:03, B*58:01 human epitope
                         KAAFDLSFF Nef(82-90) B*57:03 human epitope
                         KAAVDLSHF Nef(82-90) B*58:01 human epitope
                         KAAFDLSFF Nef(82-90) B*58:01 human epitope
                         KAAFDLgFF Nef(82-90) escape documented in this paper
                         KAAFDLSFF Nef(82-90) B*58:01 human epitope
                         KAAFDLSFF Nef(82-90) B*58:01 human epitope
                         KeAFDLSFF Nef(82-90) escape documented in this paper
                         {f}KAAFDLgFF Nef(82-90) escape documented in this paper
                         KgAFDLSFF Nef(82-90) escape documented in this paper
                         KgAvDLSFF Nef(82-90) escape documented in this paper
                         rAAFDLSFF Nef(82-90) escape documented in this paper
                         KAAvDLSFF Nef(82-90) escape documented in this paper
                         {f}KAAFDLSFF Nef(82-90) escape documented in this paper
                         -----LSFF Nef(82-90) escape documented in this paper
                         KAAFDLSFF Nef(82-90) B*58:01 human epitope
                         KAAFDLgFF Nef(82-90) altered HLA expression; observed variant; replicative capacity reduced
                         KAAIDLSHF Nef(82-90) B*58:01 humanized mouse epitope
                         KAAmDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                         KAAlDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                         KAAvDLSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                         KAAIDiSHF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                         KAAIDLSlF Nef(82-90) escape documented in this paper; inferred escape; observed variant
                         KAAFDLSFF Nef(82-90) B*58:01 human epitope
                         KAAFDLSFF Nef(82-90) B*58:01 human epitope
                         KAAVDLSHF Nef(82-90) C*12:02 human epitope
                         KgAlDLSHF Nef(82-90) non-susceptible form
                         KGALDLSHF Nef(82-90) C*12:02 human epitope
                         KaAvDLSHF Nef(82-90) observed variant
                         KAALDLSHF Nef(82-90) human epitope
                         KAAFDLSFF Nef(82-90) human epitope
                         KAAVDLSFF Nef(82-90) human epitope
                         KAAVDLSFF Nef(82-90) human epitope
                         KAAVDLSHFL Nef(82-91) A*11 human epitope
                         KAALDLSHFL Nef(82-91) A2 human epitope
                         KAAvDLSHFL Nef(82-91) susceptible form
                         KAAVDLSHFL Nef(82-91) B*57 human epitope
                         KAALDLSHFL Nef(82-91) B*57:01 human epitope
                         KAALDLSHlL Nef(82-91) observed variant
                         rAALDLSHFL Nef(82-91) observed variant
                         rAALDLSHlL Nef(82-91) observed variant
                         rAAvDLSHFL Nef(82-91) observed variant
                         KgALDLSHFL Nef(82-91) observed variant
                         KAAvDLSHFL Nef(82-91) observed variant
                         KAAFDLSFFL Nef(82-91) B*57:02, B*57:03, B*58:01 human epitope
                         KgAFDLSFFL Nef(82-91) HLA association
                         KAAVDLSHFL Nef(82-91) C*03 human epitope
                         KAAVDLSHFL Nef(82-91) C*08 human epitope
                         KAAVDLSHFL Nef(82-91) C*08 human epitope
                         KAAlDLSHFL Nef(82-91) susceptible form
                         KAAlDiSHFL Nef(82-91) susceptible form
                         KgAVDLSHFL Nef(82-91) susceptible form
                         KgAlDLSHFL Nef(82-91) susceptible form
                         KAAVDLSHFL Nef(82-91) C*08:02 human epitope
                         KAAFDLSFFL Nef(82-91) C*08:04 human epitope
                         KAAVDLSHFL Nef(82-91) Cw8 human epitope
                         KAAVDLSMFL Nef(82-91) Cw8 human epitope
                         KAAVDLSHFL Nef(82-91) Cw8 human epitope
                         KAAVDLSHFL Nef(82-91) Cw8 human epitope
                         KAAVDLSHFL Nef(82-91) Cw8 human epitope
                         KAAVDLSHFL Nef(82-91) Cw8 human epitope
                         KAAVDLSHFL Nef(82-91) Cw8 human epitope
                         KAAVDLSHFL Nef(82-91) Cw8 human epitope
                         KAAVDLSHFLK Nef(82-92) A*11:01 human epitope
                         KGAFDLSFFLKEKGG Nef(82-96) human epitope
                         KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
                         KAAVDLSHFLKEKGGLEGLI Nef(82-101) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health