HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

NAACAWLEAQEEEEVGFPVT Nef(52-71) human epitope
     WLEAQEEEEVGFPVR Nef(57-71) human epitope
     WLRAQEEEEEVGFPVRPQV Nef(57-74) C*06 human epitope
     WLEAQEEDSDVGFPVRPQV Nef(57-74) human epitope
     WLEAQEEDSeVGFPVRPQV Nef(57-74) observed variant
     WLEAQEEEEVGFPVRPQV Nef(57-74) human epitope
     WLEAQEEEEVGFPVRPQV Nef(57-74) human epitope
         QEEEEVGFPVRPQVP Nef(61-75) B57 human epitope
         QEEEEVGFPVRPQVP Nef(61-75) human epitope
         QEEEEVGFPVRPQVPLRPMT Nef(61-80) human epitope
          EEEEVGFPVR Nef(62-71) A*02, B*45 human epitope
          EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
          EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
          EEEEVGFVTPQVPLRPMTY Nef(62-81) human epitope
          EEEEVGFPVTPQVPLRPMTY Nef(62-81) human epitope
           EEGVGFPVRPQ Nef(63-73) B*45:01 human epitope
           EEEVGFPVKPQVPLR Nef(63-77) B7 human epitope
           EEEVGFPVRPQVPLR Nef(63-77) human epitope
           EEEVGFPVRPQVPLR Nef(63-77) human epitope
            GEVGFPVRPQV Nef(64-74) B45 human epitope
            EEVGFPVRPQV Nef(64-74) B*45:01 human epitope
            EEVGFPVKPQV Nef(64-74) B*45:01 human epitope
            dEVGFPVKPQV Nef(64-74) diminished response; escape documented in this paper
            dEVGFPVrPQV Nef(64-74) diminished response; escape documented in this paper
            gEVGFPVrPQV Nef(64-74) susceptible form
            EEVGFPVRPQV Nef(64-74) B*45:01 human epitope
            EEVGFPVRPQV Nef(64-74) human epitope
            EEVGFPVKPQV Nef(64-74) human epitope
            EEVGFPVRPQV Nef(64-74) human epitope
             EVGFPVRPQVPL Nef(65-76) human epitope
             EVGFPiRPQVPL Nef(65-76) observed variant
             gVGFPVRPQVPL Nef(65-76) observed variant
             EmGFPVRPQVPL Nef(65-76) observed variant
             kVGFPVRPQVPL Nef(65-76) observed variant
             EVGFPVRPQVPLRPM Nef(65-79) human epitope
             EVGFPVRPQVPLRPM Nef(65-79) human epitope
             EVGFPVRPQVPLRPMTFK Nef(65-82) C*03, C*04, C*12 human epitope
             EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
             EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
             EVGFPVRPQVPLRPMTfK Nef(65-82) subtype-specific susceptible form
             EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
             EVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
             EVGFPVtPQVPLRPMTYK Nef(65-82) observed variant
             DVGFPVRPQVPLRPMTYK Nef(65-82) human epitope
             eVGFPVRPQVPLRPMTYK Nef(65-82) observed variant
              VGFPVRPQV Nef(66-74) A*02:01 human epitope
              VGFPVRPQV Nef(66-74) human epitope
              VGFPVTPQVPLRMT Nef(66-80) A1, B8 human epitope
              VGFPVTPQVPLRMT Nef(66-80) A1, B8 human epitope
              VGFPVTPQVPLRPMTYK Nef(66-82) A*11:01 human epitope
              VGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGL Nef(66-97) human epitope
               GFPVRPQVPLRPMTY Nef(67-81) human epitope
               GFPVRPQVPLRPMTY Nef(67-81) human epitope
               GFPVRPQVPLRPMTY Nef(67-81) human epitope
                FPVTPQVPL Nef(68-76) A*68:02 human epitope
                FPVTPQVPL Nef(68-76) B*07 human, transgenic mouse epitope
                FPVTPQVPL Nef(68-76) B*07 human epitope
                FPVTPQVPL Nef(68-76) B*07 human epitope
                FPVTPQVPL Nef(68-76) B*07 human epitope
                FPVRPQVPL Nef(68-76) B*07:02 human epitope
                FSVRPQVPL Nef(68-76) susceptible form
                FPARPQVPL Nef(68-76) susceptible form
                SPVRPQVPL Nef(68-76) susceptible form
                FPIRPQVPL Nef(68-76) observed variant
                FPVRPQVPL Nef(68-76) B*07:02 human epitope
                FPVRPQVPL Nef(68-76) B*07:02 human epitope
                FPVRPQVPL Nef(68-76) B*07:02 human epitope
                FPVKPQVPL Nef(68-76) B*07:02 human epitope
                FPVrPQVPL Nef(68-76) non-susceptible form; susceptible form
                FPVtPQVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                FPVRPQVPL Nef(68-76) B*07:02 human epitope
                FPVkPQVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
                FPVkPQVPv Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
                FPVkPrVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
                FPVkPQVsL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
                FPVtPQVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
                FPVtPQVPv Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
                FPVtPrVPL Nef(68-76) diminished response; escape documented in this paper; non-susceptible form
                FPVKPQVPL Nef(68-76) B*07:02 human epitope
                FPVRPQVPL Nef(68-76) B*07:02 human epitope
                FPVkPQVPL Nef(68-76) inferred escape; literature escape
                FPVTPQVPL Nef(68-76) B*07:02 human epitope
                FPVTPQVPL Nef(68-76) B*35 human epitope
                FPVRPQVPL Nef(68-76) B*35 human epitope
                FPVRPQVPL Nef(68-76) B*35 human epitope
                FPVkPQVPL Nef(68-76) susceptible form
                FPVRPQVPL Nef(68-76) B35 human epitope
                FPVRPQVPL Nef(68-76) B35 human epitope
                FPVTPQVPL Nef(68-76) B35 human epitope
                FPVRPQVPL Nef(68-76) B35 human epitope
                FPVKPQVPL Nef(68-76) B35, B7 human epitope
                FPVKPQVPL Nef(68-76) B35, B7 human epitope
                FPVRPQVPL Nef(68-76) B*35:01 human epitope
                FPVRPQVPL Nef(68-76) B*35:01 human epitope
                FPVRPQVPL Nef(68-76) B*35:01 human epitope
                FPVRPQVPL Nef(68-76) B*35:01, B7 human epitope
                FPVRPQVPL Nef(68-76) B7 human epitope
                FPVTPQVPL Nef(68-76) B7 human epitope
                FPVTPQVPL Nef(68-76) B7 human epitope
                FPVRPQVPL Nef(68-76) B7 human epitope
                FPVRPQVPL Nef(68-76) B7 human epitope
                FPVtPQVPL Nef(68-76) observed variant
                FPVTPQVPL Nef(68-76) B7 supertype human epitope
                FPVRPQVPL Nef(68-76) B7 supertype human, mouse epitope
                FPVKPQVPL Nef(68-76) human epitope
                FPVrPQVPL Nef(68-76) susceptible form
                FPVRPQVPL Nef(68-76) human epitope
                FPVtPQVPL Nef(68-76) escape documented in this paper
                FPVkPQVPL Nef(68-76) diminished response
                FPVTPQVPLR Nef(68-77) A*68:02 human epitope
                FPVTPQVPLR Nef(68-77) B*07 human epitope
                FPVTPQVPLR Nef(68-77) B*07 human, transgenic mouse epitope
                FPVrPQVPLR Nef(68-77) non-susceptible form
                FPVTPQVPLR Nef(68-77) B*07 human epitope
                FPVTPQVPLR Nef(68-77) B*07, B*35 human epitope
                FPVTPQVPLR Nef(68-77) B*07:02 human epitope
                FPVTPQVPLR Nef(68-77) B*07:02 human epitope
                FPVRPQVPLR Nef(68-77) B*07:02 human epitope
                FPVkPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
                FPVkPQVPvR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
                FPVkPQePLi Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
                FPVtPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
                FPVtPQVPLt Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
                FPVKPQVPLR Nef(68-77) B*07:02 human epitope
                FPVrPQVPLR Nef(68-77) non-susceptible form
                FPVtPQVPLR Nef(68-77) diminished response; escape documented in this paper; non-susceptible form
                FPVRPQVPLR Nef(68-77) B7 human epitope
                FPVTPQVPLR Nef(68-77) B7 human epitope
                FPVTPQVPLR Nef(68-77) B7 human epitope
                FPVRPQVPLR Nef(68-77) B7 human epitope
                FPVTPQVPLR Nef(68-77) B7 human epitope
                FPVTPQVPLR Nef(68-77) B7 human epitope
                FPVTPQVPLR Nef(68-77) B7 human epitope
                FPVTPQVPLR Nef(68-77) B7 human epitope
                FPVRPQVPLR Nef(68-77) B7 human epitope
                FPVtPQVPLR Nef(68-77) observed variant
                FPVTPQVPLR Nef(68-77) B*81 human epitope
                FPVTPQVPLR Nef(68-77) human epitope
                FPVRPQVPLR Nef(68-77) human epitope
                FPVkPQVPLR Nef(68-77) altered HLA expression
                FPVTPQVPLR Nef(68-77) human epitope
                FPVTPQVPLRMTY Nef(68-81) human epitope
                FPVrPQVPLRMTY Nef(68-81) observed variant
                FPVkPQVPLRMTY Nef(68-81) observed variant
                FPVTPQVPLRPMTFK Nef(68-82) A3 human epitope
                FPVRPQVPLRPMTYK Nef(68-82) A3 human epitope
                FPVRPQVPLRPMTYK Nef(68-82) B35 human epitope
                FPVRPOVPLRPMTYK Nef(68-82) human epitope
                FPVRPQVPLRPMTYKGA Nef(68-84) human epitope
                FPVRPQVPLRPMTYKaA Nef(68-84) observed variant
                 PVKPQVPLR Nef(69-77) human epitope
                 PVRPQVPLRPMTYKA Nef(69-83) human epitope
                 PVRPQVPLRPMTfKA Nef(69-83) observed variant
                  VTPQVPLRPMTYKAA Nef(70-84) human epitope
                   TPQVPLRPM Nef(71-79) A*30 human epitope
                   TPQVPLRPM Nef(71-79) A*34 human epitope
                   TPQVPLRPM Nef(71-79) A*68:02 human epitope
                   TPQVPLRPM Nef(71-79) B*07 human epitope
                   RPQVPLRPM Nef(71-79) B*07 human epitope
                   TPQVPLRPM Nef(71-79) B*07 human epitope
                   RPQVPLRPM Nef(71-79) B*07, B*81:01 human epitope
                   RPQVPLRPM Nef(71-79) B*07:02 human epitope
                   TPQVPLRPM Nef(71-79) B*07:02 human epitope
                   RPQVPLRPM Nef(71-79) B*07:02 human epitope
                   kPQVPLRPM Nef(71-79) inferred escape
                   RPQVPLRPM Nef(71-79) B*07:02, B*42:01, B*81:01, B7, B81 human epitope
                   RPQVPLRPM Nef(71-79) B*07:02, B*81:01 human epitope
                   RPQVPvRPM Nef(71-79) altered HLA expression; observed variant; replicative capacity reduced
                   RPQVPLRPM Nef(71-79) B*07:02, B*81:01 human epitope
                   TPQVPLRPM Nef(71-79) B*35 human epitope
                   TPQVPLRPM Nef(71-79) B35 human epitope
                   RPQVPLRPM Nef(71-79) B*35:01 human epitope
                   RPQVPLRPM Nef(71-79) B*35:02, B*35:03, B*53:01 human epitope
                   RPQVPLRPM Nef(71-79) B*39 human epitope
                   RPQVPLRPM Nef(71-79) B*42 human epitope
                   RPQVPLRPM Nef(71-79) B*42 human epitope
                   TPQVPLRPM Nef(71-79) B42 human epitope
                   RPQVPLRPM Nef(71-79) B42 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:01, B*42:02 human epitope
                   RPQQVPLRPM Nef(71-79) B*42:01, B*81:01 human epitope
                   RPQVPLRPM Nef(71-79) B*42:02 human epitope
                   RPQVPLRPM Nef(71-79) B*42:02 epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   RPQVPLRPM Nef(71-79) B7 human epitope
                   tPQVPLRPM Nef(71-79) observed variant
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B7 human epitope
                   TPQVPLRPM Nef(71-79) B*78 human epitope
                   RPQVPLRPM Nef(71-79) B*78 human epitope
                   TPQVPLRPM Nef(71-79) B7 supertype human epitope
                   RPQVPLRPM Nef(71-79) B*81 human epitope
                   RPQVPLRPM? Nef(71-79) B81 human epitope
                   RPQVPLRPM Nef(71-79) B*81:01 human epitope
                   RPQVPvRPM Nef(71-79) calculated escape
                   RPQVPtRPM Nef(71-79) observed variant
                   RPQVPmRPM Nef(71-79) observed variant
                   RPQmPLRPM Nef(71-79) observed variant
                   kPQVPvRPM Nef(71-79) observed variant
                   RPQVPiRPM Nef(71-79) observed variant
                   tPQVPIRPM Nef(71-79) observed variant
                   RPQVPLRPM Nef(71-79) B*81:01 human epitope
                   RPQVPvRPM Nef(71-79) literature escape
                   RPQaPLRPM Nef(71-79) observed variant
                   kPQVPLRPM Nef(71-79) observed variant
                   RPQVPiRPM Nef(71-79) literature escape
                   RPQVPtRPM Nef(71-79) literature escape
                   RPQVPLRPM Nef(71-79) B*81:01 human epitope
                   RPQVPLRPM Nef(71-79) B*82 human epitope
                   RPQVPLRPM Nef(71-79) C*04 human epitope
                   RPQVPLRPM Nef(71-79) C*17 human epitope
                   RPQVPLRPM Nef(71-79) human epitope
                   RPQVPLRPM Nef(71-79) human epitope
                   kPQVPLRPM Nef(71-79) susceptible form
                   tPQVPLRPM Nef(71-79) observed variant
                   RPQVPvRPM Nef(71-79) escape documented in this paper
                   RPQVPtRPM Nef(71-79) escape documented in this paper
                   tPQVPLkPM Nef(71-79) observed variant
                   RPQaPLRPM Nef(71-79) observed variant
                   RPQVPmRPM Nef(71-79) observed variant
                   kPQVPvRPM Nef(71-79) observed variant
                   RPQmPLRPM Nef(71-79) observed variant
                   RPQVPiRPM Nef(71-79) escape documented in this paper
                   cPQVPLRPM Nef(71-79) observed variant
                   RPQVrLRPM Nef(71-79) observed variant
                   RPQVlLRPM Nef(71-79) observed variant
                   TPQVPLRPMTY Nef(71-81) B*07, B*35 human epitope
                   RPQVPLRPMTY Nef(71-81) B*35 human epitope
                   RPQVPLRPMTY Nef(71-81) B*35 human epitope
                   tPQVPLRPMTY Nef(71-81) diminished response
                   RPQVPLRPMTY Nef(71-81) B*35 human epitope
                   RPQVPLRPMTf Nef(71-81) susceptible form
                   tPQVPLRPMTY Nef(71-81) escape documented in this paper
                   tPQVPLRPMTf Nef(71-81) observed variant
                   RPQVPLRPMTY Nef(71-81) B35 human epitope
                   RPQVPLRPMTf Nef(71-81) susceptible form
                   RPQVPLRPMTY Nef(71-81) B35 human epitope
                   tPQVPLRPMTY Nef(71-81) escape documented in this paper
                   tPQVPLRPMTf Nef(71-81) escape documented in this paper
                   RPQVPLRPMTY Nef(71-81) B35 human epitope
                   RPQVPLRPMTY Nef(71-81) B35 human epitope
                   tPQVPLRPMTY Nef(71-81) escape documented in this paper; TCR related mutation
                   RPQVPLRPMTY Nef(71-81) B35 human epitope
                   TPQVPLRPMTY Nef(71-81) B35 human epitope
                   RPQVPLRPMTY Nef(71-81) B35 human epitope
                   kPQVPLRPMTY Nef(71-81) altered HLA expression; observed variant; replicative capacity reduced
                   RPQVPLRPMTY Nef(71-81) B35 human epitope
                   RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
                   RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
                   RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
                   RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
                   RPQVPLRPMTf Nef(71-81) observed variant; replicative capacity is not abrogated
                   kPQVPLRPMTY Nef(71-81) observed variant; replicative capacity is not abrogated
                   RPQVPLRPMdY Nef(71-81) observed variant; replicative capacity is not abrogated
                   RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
                   RPQVPLRPMTY Nef(71-81) B*35:01 human epitope
                   tPQVPLRPMTY Nef(71-81) escape documented in this paper
                   tPQVPLRPMTf Nef(71-81) escape documented in this paper
                   RPQVPLRPMTY Nef(71-81) B51 human, macaque epitope
                   TPQVPLRPMTY Nef(71-81) B7 human epitope
                   TPQVPLRPMTY Nef(71-81) B7 supertype human epitope
                   rPQVPLRPMTY Nef(71-81) susceptible form
                   RPQVPLRPMTY Nef(71-81) human epitope
                   RPQVPLRaMTY Nef(71-81) HLA association
                   KPQVPLRPMTYKAAV Nef(71-85) A3, B35 human epitope
                   RPQVPLRPMTYKAAL Nef(71-85) human epitope
                   RPQVPLRPMTYKAAL Nef(71-85) human epitope
                   RPQVPLRPMTYKAAL Nef(71-85) human epitope
                   RPQVPLRPMTYKAAVDLSHF Nef(71-90) human epitope
                    PQVPLRPMTY Nef(72-81) B35 human epitope
                    PQVPLRPMTY Nef(72-81) B35, B51 human epitope
                    PQVPLRPMTY Nef(72-81) B*51 human epitope
                    PQVPLRPMTYKGAFD Nef(72-86) human epitope
                    PQVPLRRMTYKAAVDLSHFL Nef(72-91) human epitope
                    PQVPLRPMTYKAAVDLSHFL Nef(72-91) human epitope
                    PQVPLRMTYKAAVDLSHFL Nef(72-91) human epitope
                     QVPLRPMTY Nef(73-81) A1 human epitope
                     QVPLRPMTY Nef(73-81) A*80:01 human epitope
                     QVPLRPMTY Nef(73-81) B*07 human epitope
                     QVPLRPMTY Nef(73-81) B*35 human epitope
                     QVPLRPMTY Nef(73-81) B*35:01 human epitope
                     QVPLRPMTY Nef(73-81) human epitope
                     QVPvRPMTY Nef(73-81) susceptible form
                     QaPLRPMTY Nef(73-81) non-susceptible form; susceptible form
                     QVPLRPMTf Nef(73-81) non-susceptible form; susceptible form
                     QVPaRPMTY Nef(73-81) non-susceptible form; susceptible form
                     QVPLRaMTY Nef(73-81) non-susceptible form; susceptible form
                     QVPLaPMTY Nef(73-81) non-susceptible form; susceptible form
                     QVPLRPMTYK Nef(73-82) A*02:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*02:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03 human epitope
                     QVPLRPMTYK Nef(73-82) A*03 human epitope
                     QVPLRPMTYK Nef(73-82) A*03 human epitope
                     QVPLRPMTYK Nef(73-82) A*03 human epitope
                     QVPLRPMTYK Nef(73-82) A*03 human epitope
                     QVPLRPMTYK Nef(73-82) A*03 human epitope
                     QVPLRPMTYK Nef(73-82) A*03, A*11, A*31, B*27, B*35 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK{gA} Nef(73-82) inferred escape
                     QVPLRPMTfK{gA} Nef(73-82) inferred escape
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTeK Nef(73-82) diminished response
                     QVPvRPMTYK Nef(73-82) diminished response
                     QVPiRPMTYK Nef(73-82) diminished response
                     QVPLRPMTYq Nef(73-82) diminished response
                     QVPLRPMTrr Nef(73-82) non-susceptible form
                     QVPLRPMTYr Nef(73-82) non-susceptible form; susceptible form
                     hVPLRPMTYK Nef(73-82) diminished response; susceptible form
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01 human epitope
                     QiPLRPMTYK Nef(73-82) susceptible form
                     QVPLaPMTYK Nef(73-82) diminished response
                     QVPLgPMTYK Nef(73-82) diminished response
                     QVPLgPMsYK Nef(73-82) susceptible form
                     QVPLRPMaYK Nef(73-82) diminished response
                     QVPLRPaTYK Nef(73-82) diminished response
                     aVPLRPMTYK Nef(73-82) susceptible form
                     QaPLRPMTYK Nef(73-82) susceptible form
                     QVaLRPMTYK Nef(73-82) susceptible form
                     QVPaRPMTYK Nef(73-82) susceptible form
                     QVPLRaMTYK Nef(73-82) susceptible form
                     QVPLRPMTaK Nef(73-82) susceptible form
                     QVPLRPMTYa Nef(73-82) susceptible form
                     QVPLRPMTYK Nef(73-82) A*03:01, A*11 human epitope
                     QiPLRPMTYK Nef(73-82) diminished HLA binding or increased off-rate; observed variant
                     QVPLRPMTYK Nef(73-82) A*03:01, A11 human epitope
                     QVPLRPMTYK Nef(73-82) A*03:01, A11 human, macaque epitope
                     QVPLRPMTYK Nef(73-82) A03 supertype human epitope
                     QVPLRPMTYK Nef(73-82) A*11 human epitope
                     QVPLRPMTYK Nef(73-82) A*11 human epitope
                     QVPLRPMTYK Nef(73-82) A*11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTsr Nef(73-82) diminished HLA binding or increased off-rate
                     {r*}QVPLRPMTYK{g} Nef(73-82) inferred escape; processing
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11 human epitope
                     QVPLRPMTYK Nef(73-82) A11, A2, A3, B35 human epitope
                     QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                     QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                     QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                     QVPLRPMTYK Nef(73-82) A11, A3 human epitope
                     QVPvRPMTYK Nef(73-82) observed variant
                     QVPmRPMTYK Nef(73-82) observed variant
                     QVPLRPMTfK Nef(73-82) susceptible form
                     QVPLRPMYTK Nef(73-82) A11, A3 human epitope
                     QVPLRPMTYK Nef(73-82) A11, A3, A30 epitope
                     QVPLRPMTYK Nef(73-82) A11, A3, B35 human epitope
                     QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                     QVPLRPMTYK Nef(73-82) A*11:01 epitope
                     QVPLRPMTYK Nef(73-82) A*11:01 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTfK Nef(73-82) susceptible form
                     QVPLkPMTfK Nef(73-82) diminished response
                     QVPLRPMnYK Nef(73-82) diminished response
                     QVPvRPMTfK Nef(73-82) escape documented in this paper
                     QVPLRPMsYr Nef(73-82) escape documented in this paper
                     QVPLRPMsYK Nef(73-82) susceptible form
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     {k*}QVPLRPMTYK{g} Nef(73-82) escape documented in this paper; processing
                     QVPLRRMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRRMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A3 human epitope
                     QVPLRPMTYK Nef(73-82) A*33 human epitope
                     QVPLRPMTYK Nef(73-82) A*34 human epitope
                     QVPLRPMTYK Nef(73-82) A3 supertype human epitope
                     QVPLRPMTYK Nef(73-82) A*66 human epitope
                     QVPLRPMTYK Nef(73-82) B*08 human epitope
                     QVPLRPMTYK Nef(73-82) B27 human epitope
                     SVPLRPMTYK Nef(73-82) B35, Cw4 human epitope
                     QVPLRPMTYK Nef(73-82) B*35:02, B*35:03, B*53:01 human epitope
                     QVPLRPMTYK Nef(73-82) B8 human epitope
                     SVPLRPMTYK Nef(73-82) C*04 human epitope
                     QVPVRPMTYK Nef(73-82) C*08 human epitope
                     QVPLRPMTYK Nef(73-82) human epitope
                     QVPLRPMTYK Nef(73-82) human epitope
                     QVPLRPMTYK Nef(73-82) human epitope
                     QVPLRPMTYK Nef(73-82) human epitope
                     QVPLRPMTYK Nef(73-82) human epitope
                     QVPLRPMTYKA Nef(73-83) A3 human epitope
                     QVPLRPMTYKAAVDL Nef(73-87) B57 human epitope
                     QVPLRPMTYKAAVDL Nef(73-87) human epitope
                     QVPLRPMTfKAAVDL Nef(73-87) observed variant
                     QVPLRPMTYKAAVDL Nef(73-87) human epitope
                     AVPLRPMTYKAAFDLSFF Nef(73-90) A*68:02 human epitope
                     QVPLRPMTYKGALDLSHF Nef(73-90) human epitope
                     QVPLRPMTYKAAVDLSHF Nef(73-90) human epitope
                     QVPLRPMTYKAAFDLSFFLKEKG Nef(73-95) human epitope
                      VPLRPMTY Nef(74-81) A*11 human epitope
                      VPLRPMTY Nef(74-81) A3 human epitope
                      VPLRPMTY Nef(74-81) B*07 human epitope
                      VPLRPMTY Nef(74-81) B*35 human epitope
                      VPLRPMTY Nef(74-81) B*35 human epitope
                      VPLRPMTY Nef(74-81) B*35 human epitope
                      VPLRPMTY Nef(74-81) B*35 epitope
                      VPLRPMTY Nef(74-81) B*35 human epitope
                      VPLRPMTY Nef(74-81) B*35 human epitope
                      VPLRPMTf Nef(74-81) literature escape
                      VPLRPMTY Nef(74-81) B*35, B*53 human epitope
                      VPLRPMTf Nef(74-81) escape documented in this paper
                      lPLRPMTY Nef(74-81) observed variant
                      VPLRPiTY Nef(74-81) observed variant
                      VPLRPMTt Nef(74-81) observed variant
                      VPLRPMnY Nef(74-81) observed variant
                      VPLRPMTY Nef(74-81) B*35, B*53:01 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTf Nef(74-81) escape documented in this paper
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMsY Nef(74-81) escape documented in this paper
                      VPLRPMTf Nef(74-81) escape documented in this paper
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human, macaque epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35 human epitope
                      VPLRPMTY Nef(74-81) B35, B42 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTf Nef(74-81) escape documented in this paper
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTf Nef(74-81) diminished response
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTF Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPvRPMTY Nef(74-81) observed variant; susceptible form
                      VPLRPMTf Nef(74-81) diminished response; non-susceptible form; TCR related mutation
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:01 human epitope
                      VPLRPMTY Nef(74-81) B*35:02, B*35:03, B*53:01 human epitope
                      VPLRPMTY Nef(74-81) B*55 human epitope
                      VPLRPMTY Nef(74-81) B*78 human epitope
                      VPLRPMTY Nef(74-81) B*81 human epitope
                      VPLRPMTY Nef(74-81) C*12 human epitope
                      VPLRPMTY Nef(74-81) human epitope
                      VPLRPMTY Nef(74-81) human epitope
                      VPLRPMTYK Nef(74-82) A11 human epitope
                      VPLRPMTFK Nef(74-82) human epitope
                      VPLRPMTYKA Nef(74-83) B7 human epitope
                      VPLRPMTYRAARDLS Nef(74-88) B7 supertype human epitope
                      IPLRPMTYKGALDLS Nef(74-88) B7 supertype human epitope
                       PLRPMYTK Nef(75-82) A11 human epitope
                       PLRPMTYK Nef(75-82) A11 human epitope
                       PLRPMTYK Nef(75-82) A*11:01 human epitope
                       PLRPMTYK Nef(75-82) A*11:01 human epitope
                       PLRPMTYK Nef(75-82) B*15:01 human epitope
                       PLRPMTYK Nef(75-82) C*02 human epitope
                       PLRPMTYKAALDLSH Nef(75-89) human epitope
                        LRPMTYKAA Nef(76-84) B*27:03 human epitope
                        LRPMTYKAA Nef(76-84) B*27:03 human epitope
                         RPMTYKAAL Nef(77-85) A*32 human epitope
                         RPMTYKAAL Nef(77-85) B*07 human epitope
                         RPMTYKAAV Nef(77-85) B*07 human epitope
                         RPMTYKAAL Nef(77-85) B*07 human epitope
                         RPMTYKAAV Nef(77-85) B*07 human epitope
                         RPMTYKAAL Nef(77-85) B*07 human epitope
                         RPMTYKAAL Nef(77-85) B*07 human epitope
                         RPMThqAAw Nef(77-85) diminished response; susceptible form
                         RPMTYKAAL Nef(77-85) B*07 human, transgenic mouse epitope
                         RPMTYKgAL Nef(77-85) susceptible form
                         RPMTYKAAv Nef(77-85) susceptible form
                         RPMTfKAAL Nef(77-85) susceptible form
                         RPMTYKfAL Nef(77-85) susceptible form
                         RPMTYKAAf Nef(77-85) susceptible form
                         RPMTYKGAL Nef(77-85) B*07 human epitope
                         RPMTYKAAL Nef(77-85) B*07 human epitope
                         RPMTFKGAL Nef(77-85) B*07:02 human epitope
                         RPMTFKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTFKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTyKaAi Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTyKaAf Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTyKGAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTyKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTyKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTyKGAL Nef(77-85) susceptible form
                         RPMTYKGAL Nef(77-85) B*07:02 human epitope
                         RPMTYKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                         RPMTYKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                         RPMTYKaAf Nef(77-85) diminished response; escape documented in this paper; susceptible form
                         RPMTYKaAi Nef(77-85) diminished response; escape documented in this paper; susceptible form
                         RPMTfKaAL Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTfKaAv Nef(77-85) diminished response; escape documented in this paper; non-susceptible form
                         RPMTYKgAv Nef(77-85) diminished response; escape documented in this paper; susceptible form
                         RPMTFKGAL Nef(77-85) B*07:02 human epitope
                         RPMTYKGAL Nef(77-85) B*07:02 human epitope
                         RPMTfKGAL Nef(77-85) inferred escape; literature escape
                         RPMTYKAAL Nef(77-85) B*07:02 human epitope
                         RPMTYKAAV Nef(77-85) B*07:02 human epitope
                         RPMTYKAAf Nef(77-85) subtype-specific susceptible form
                         RPMTYKAAL Nef(77-85) B*07:02 human epitope
                         RPMTYKAAL Nef(77-85) B*07:02 human epitope
                         RPMTYKAAL Nef(77-85) B*18 human epitope
                         RPMTYKAAV Nef(77-85) B*42:01 human epitope
                         RPMTFKGAF Nef(77-85) B*42:01, B*42:02 human epitope
                         RPMTYKAAV Nef(77-85) B7 human epitope
                         RPMTYKAAL Nef(77-85) B7 human epitope
                         RPMTYKGAL Nef(77-85) B7 human epitope
                         RPMTYKaAv Nef(77-85) observed variant
                         RPMTYKaAL Nef(77-85) observed variant
                         RPMTYKAAV Nef(77-85) B7 human epitope
                         RPMTYKAAL Nef(77-85) B7 human epitope
                         RPMTYKAAV Nef(77-85) B7 human epitope
                         RPMTYKAAl Nef(77-85) observed variant
                         RPMTYKgAi Nef(77-85) non-susceptible form; susceptible form
                         RPMTYKgAl Nef(77-85) observed variant
                         RPMTYKgAf Nef(77-85) observed variant
                         RPMTfKgAf Nef(77-85) observed variant
                         RPMTfKAAV Nef(77-85) observed variant
                         RPMTYKeAV Nef(77-85) observed variant
                         RPMTYKAAL Nef(77-85) B7 human epitope
                         RPMTYKAAL Nef(77-85) B7 human epitope
                         RPMTYKAAV Nef(77-85) B7 human epitope
                         RPMTYKAAV Nef(77-85) B7 human epitope
                         RPMTYKGAL Nef(77-85) B7 human epitope
                         RPMTYKGAL Nef(77-85) B7 human epitope
                         RPMTYrGAL Nef(77-85) observed variant
                         RPMTYKaAL Nef(77-85) observed variant
                         RPMTYKGAv Nef(77-85) observed variant
                         RPMsYKaAL Nef(77-85) observed variant
                         RPMTfKGAL Nef(77-85) observed variant
                         RPMTYKAAV Nef(77-85) B7 human epitope
                         RPMTYKAAL Nef(77-85) B7 human epitope
                         RPMTYKAAL Nef(77-85) B7 human epitope
                         RPMTYKGAL Nef(77-85) B7 supertype human epitope
                         RPMTYraAr Nef(77-85) susceptible form
                         RPMTYKAAL Nef(77-85) B*81 human epitope
                         RPMTYKAAL Nef(77-85) B*82 human epitope
                         RPMTYKAAV Nef(77-85) B*82 human epitope
                         RPMTYKAAV Nef(77-85) C*08 human epitope
                         RPMTYKAAL Nef(77-85) C*17 human epitope
                         RPMTYKGAL Nef(77-85) human epitope
                         RPMTYKAAV Nef(77-85) human epitope
                         RPMTWKGAL Nef(77-85) human epitope
                         RPMTWKAAL Nef(77-85) susceptible form
                         RPMTYKGAL Nef(77-85) susceptible form
                         RPMTRKAAL Nef(77-85) susceptible form
                         RPMTCKGAL Nef(77-85) susceptible form
                         RPMTYKAAL Nef(77-85) observed variant
                         RPITYKAAL Nef(77-85) susceptible form
                         RPMTYKAAV Nef(77-85) human epitope
                         RPMTYKAAV Nef(77-85) human epitope
                         RPMTYKAALDLSHFL Nef(77-91) B62 human epitope
                         RPMTYKGAVDLSHFL Nef(77-91) B62 human epitope
                         RPMTYKAAVDLSHFL Nef(77-91) human epitope
                         RPMTfKAAVDLSHFL Nef(77-91) observed variant
                         RPMTYKGAFDLSFFL Nef(77-91) human epitope
                         RPMTYKAAVDLSHFLK Nef(77-92) A*02:01 human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health