logo image

HIV Molecular Immunology Database

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

TQGYFPDWQNYTPGPGVRYPLTFGWCYKLVP Nef(117-147) human epitope
 QGYFPDWQNYTPGPGVRY Nef(118-135) C*16 human epitope
 QGYFPDWQNYTPGPGIRY Nef(118-135) human epitope
 QGYFPDWQNYTPGPGRF Nef(118-135) human epitope
 QGYFPDWQNYTPGPvRy Nef(118-135) subtype-specific susceptible form
 QGYFPDWQNYTPGPGIRY Nef(118-135) human epitope
   YFPDWQNYTPGPGIR Nef(120-134) human epitope
   YFPDWQNYTPGPGIRYPLTFGWCYK Nef(120-144) A24 human epitope
    FPDWQNYTPGPGIRY Nef(121-135) A*02:01 human epitope
    FPDWQNYTPGPGIRY Nef(121-135) A24 human epitope
    FPDWQNYTPGPGIRY Nef(121-135) human epitope
    FPDWQNYTPGPGIRYPLT Nef(121-138) human epitope
    FPDWQNYTPGPGIRYPLT Nef(121-138) human epitope
    FPDWQNYTPGPGtRYPLT Nef(121-138) observed variant
     PDWQNYTPGPGVRYP Nef(122-136) human epitope
     PDWQNYTPGPGVRYPLTFGW Nef(122-141) B*35 human epitope
     PDWQNYTPGPGVRYPLTFGW Nef(122-141) human epitope
      QWQNYTPGPGVRYPL Nef(123-137) human epitope
       WQNYTPGPGIRYPLT Nef(124-138) human epitope
       WQNYTPGPGIRYPLT Nef(124-138) human epitope
        QNYTPGPGIRYPLTF Nef(125-139) A*02:01 human epitope
        QNYTPGPGVRYPLTF Nef(125-139) human epitope
        QNYTPGPGRFPLTFGWCF Nef(125-143) human epitope
        QNYTPGPGvRyPLTFGWCF Nef(125-143) subtype-specific susceptible form
         NYTPGPGVRY Nef(126-135) A24 human epitope
         NYTPGPGIRY Nef(126-135) A*24:02 human epitope
         NYTPGPGvRY Nef(126-135) observed variant
         cYTPGPGtRY Nef(126-135) observed variant
         NYTPGPGtRY Nef(126-135) observed variant
         NYTPGPGIRf Nef(126-135) observed variant
         NYTPGPGtRf Nef(126-135) observed variant
         cYTPGPGIRf Nef(126-135) observed variant
         gYTPGPGIRf Nef(126-135) observed variant
         cYTPGPGtRf Nef(126-135) observed variant
         gYTPGPGtRf Nef(126-135) observed variant
         NYTPGPGvRf Nef(126-135) observed variant
         NYTPGPGeRf Nef(126-135) observed variant
         NYTPGPGvRl Nef(126-135) observed variant
         NYTPGPGtRw Nef(126-135) observed variant
         NYTPGPGIRY Nef(126-135) A*24:02 human epitope
         NYTPGPGVRYPLT Nef(126-138) B*07 human epitope
         NYTPGPGVRYPLT Nef(126-138) B7 human epitope
         NYTPGPGTRYPLTFG Nef(126-140) A24 human epitope
         NYTPGPGTRYPLTFG Nef(126-140) B35 human epitope
         NYTPGPGTRYPLTFG Nef(126-140) human epitope
         NYTPGPGVRYPLTFGWCF Nef(126-143) C*14 human epitope
         NYTPGPGIRYPLCFGWCF Nef(126-143) human epitope
         NYTPGPGIRYPLTFGWCF Nef(126-143) human epitope
         NYTPGPGIRYPLTFGWCF Nef(126-143) human epitope
          YTPGPGIRY Nef(127-135) A*23 human epitope
          YTPGPGIRY Nef(127-135) A*24 human epitope
          YTPGPGIRY Nef(127-135) B*35:02, B*35:03, B*53:01 human epitope
          YTPGPGIRY Nef(127-135) B*57 human epitope
          YTPGPGIRY Nef(127-135) B*57 human epitope
          YTPGPGIRY Nef(127-135) B57, B58 human epitope
          YTPGPGVRY Nef(127-135) B*58:01 human epitope
          YTPGPGIRY Nef(127-135) B*63 human epitope
          YTPGPGIRY Nef(127-135) human epitope
          YTPGPGIRY Nef(127-135) human epitope
          YTPGPGTRY Nef(127-135) human epitope
          YTPGPGVRY Nef(127-135) human epitope
          YTPGPGVRYPLTFGW Nef(127-141) A24 human epitope
          YTPGPGVRYPLTFGW Nef(127-141) B35 human epitope
          YTPGPGVRYPLTFGW Nef(127-141) human epitope
           TPGPGVRY Nef(128-135) B*07:02 human epitope
           TPGPGVRY Nef(128-135) B7 supertype human epitope
           TPGPGVRYP Nef(128-136) B*07 human epitope
           TPGPGVRYPL Nef(128-137) B*07 human epitope
           TPGPGVRYPL Nef(128-137) B*07 human epitope
           TPGPGVKYPL Nef(128-137) B*07 human, transgenic mouse epitope
           TPGPGiKYPL Nef(128-137) susceptible form
           TPGPGVRYPL Nef(128-137) B*07 human epitope
           TPGPGVRYPL Nef(128-137) B*07 human epitope
           TPGPGVRYPL Nef(128-137) B*07 human epitope
           TPGPGVRYPL Nef(128-137) B*07 human epitope
           TPGPGVRYPL Nef(128-137) B*07 human epitope
           TPGPGVRYPL Nef(128-137) B*07, B*42 human epitope
           TPGPGTRYPL Nef(128-137) B*07:02 human epitope
           TPGPGiRYPL Nef(128-137) non-susceptible form
           TPGPGvRYPL Nef(128-137) diminished response; escape documented in this paper; non-susceptible form; susceptible form
           TPGPGTRfPL Nef(128-137) diminished response; escape documented in this paper; non-susceptible form; susceptible form
           TPGPGVRYPL Nef(128-137) B*07:02 human epitope
           TPGPGVRYPL Nef(128-137) B*07:02 human epitope
           TPGPGIRYPL Nef(128-137) B*07:02 human epitope
           TPGPGvRYPL Nef(128-137) subtype-specific susceptible form
           TPGPGVRYPL Nef(128-137) B*07:02 human epitope
           TPGPGVRYPL Nef(128-137) B*07:02 human epitope
           TPGPGVRYPL Nef(128-137) B*07:02 human epitope
           TPGPGIRYPL Nef(128-137) B*07:02 human epitope
           TPGPGvRYPL Nef(128-137) susceptible form
           TPGPGVRYPL Nef(128-137) B*07:02 human epitope
           TPGPGIRYPL Nef(128-137) B*07:02 human epitope
           TPGPGvRYPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
           TPGPGvRfPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
           TPGPGvRwPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
           TPGPGvRlPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
           TPGPGtRfPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
           TPGPGVRYPL Nef(128-137) B*07:02, B*42:01 human epitope
           TPGPGVRYPL Nef(128-137) B*07:02, B7 human epitope
           TPGPGVRYPL Nef(128-137) B35 human epitope
           TPGPGTRYPL Nef(128-137) B35 human epitope
           TPGPGvRYPL Nef(128-137) susceptible form
           TPGPGVRYPL Nef(128-137) B35 human epitope
           TPGPGVRYPL Nef(128-137) B*35:01 human epitope
           TsGPGVRYPL Nef(128-137) susceptible form
           TPGPGVRYPL Nef(128-137) B*35:02, B*35:03, B*53:01 human epitope
           TPGPGVRYPL Nef(128-137) B*42 human epitope
           TPGPGIRYPL Nef(128-137) B42 human epitope
           TPGPGVRYPL Nef(128-137) B*42:01 human epitope
           TsGPGVRYPL Nef(128-137) diminished HLA binding or increased off-rate; escape documented in this paper
           TqGPGVRYPL Nef(128-137) diminished HLA binding or increased off-rate; escape documented in this paper
           TPGPGVRYPL Nef(128-137) B*42:01 human epitope
           TPGPGVRYPL Nef(128-137) B*42:01 human epitope
           TPGPGVRYPL Nef(128-137) B*42:01 human epitope
           TPGPGVRYPL Nef(128-137) B*42:01 human epitope
           TPGPGVRYPL Nef(128-137) B*42:01 human epitope
           TPGPGVRYPL Nef(128-137) B*42:01, B*42:02 human epitope
           TPGPGVRYPL Nef(128-137) B*42:02 epitope
           TPGPGVRYPL Nef(128-137) B7 human, macaque epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGiRYPL Nef(128-137) observed variant
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGiRYPL Nef(128-137) observed variant
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGiRYPL Nef(128-137) susceptible form
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 human epitope
           TPGPGIRYPL Nef(128-137) B7 human epitope
           TPGPGVRYPL Nef(128-137) B*81:01, B7 human epitope
           TPGPGVRYPL Nef(128-137) B*81:01, B7 human epitope
           TPGPGVRYPL Nef(128-137) B7 supertype human epitope
           TPGPGVRYPL Nef(128-137) B*81:01 human epitope
           TPGPGVRYPL Nef(128-137) C*17 human epitope
           TPGPGVRYPL Nef(128-137) human epitope
           TPGPGIRYPL Nef(128-137) human epitope
           TPGPGVRYPL Nef(128-137) human epitope
           TPGPGVRYPL Nef(128-137) human epitope
           TPGPGTRYPL Nef(128-137) human epitope
           TPGPGIRFPL Nef(128-137) susceptible form
           TPGPGIRYPL Nef(128-137) susceptible form
           TPGPGIRYPV Nef(128-137) susceptible form
           TPGPGIRFPI Nef(128-137) susceptible form
           TSGPGTRFPL Nef(128-137) susceptible form
           IPGPG-RHPL Nef(128-137) observed variant
           TPGPGVRYPL Nef(128-137) observed variant
           TPGPGPRYPL Nef(128-137) susceptible form
           TPGPGTRFPL Nef(128-137) observed variant
           TPGPGPRFPL Nef(128-137) observed variant
           TPGPGIRYPM Nef(128-137) susceptible form
           TPGPGPRYPV Nef(128-137) susceptible form
           TPGPGPRYPM Nef(128-137) susceptible form
           TKGPGIRFPL Nef(128-137) susceptible form
           TPGPGPRYPM Nef(128-137) susceptible form
           TPGPGIRYPL Nef(128-137) human epitope
           TPGPGvRYPL Nef(128-137) HLA association; susceptible form
           TPGPGRFPL Nef(128-137) human epitope
           TPGPGvryPL Nef(128-137) observed variant
           TPGPGIRYPLTFGW Nef(128-141) human epitope
           TPGPGIRYPLTFGW Nef(128-141) human epitope
           TPGPGIRYPLTFGW Nef(128-141) human epitope
            PGPGTRFPLTFGWCF Nef(129-143) A23 human epitope
            PGPGTRFPLTFGWCF Nef(129-143) A24 human epitope
            PGPGIRYPLCFGWCF Nef(129-143) B35 human epitope
            PGPGTRFPLTFGWCF Nef(129-143) B35 human epitope
            PGPGIRYPLTFGWCF Nef(129-143) B57 human epitope
            PGPGIRYPLTFGWCF Nef(129-143) human epitope
            PGPGpRYPLTFGWCF Nef(129-143) non-susceptible form; susceptible form
            PGPGIRYPLTFGWCF Nef(129-143) human epitope
            PGPGtRfPLTFGWCF Nef(129-143) observed variant
            PGPGVRYPLTFGWCFKLV Nef(129-146) human epitope
            PGPGIRYPLTFGWCFKLV Nef(129-146) human epitope
            PGPGVRYPLTFGWCFKLVP Nef(129-147) human epitope
             GPGVRYPLTF Nef(130-139) B35 human epitope
             GPGVRYPLTF Nef(130-139) B35 human epitope
             GPGTRFPLTR Nef(130-139) B7 human epitope
             GPGVRYPLTFGWCY Nef(130-143) B*57 human epitope
             GPGVRYPLTFGWCY Nef(130-143) B*57 human epitope
             GPGIRYPLTFGWCF Nef(130-143) B*57 human epitope
             GPGVRYPLTFGWCY Nef(130-143) B57 human epitope
             GPGIRYPLTFGWCF Nef(130-143) B*58:01, B57 human epitope
             GPGVRYPLTFGWCYK Nef(130-144) human epitope
             GPGTRFPLTFGWCFKLV Nef(130-146) human epitope
              PGIRYPLTFGWCFKL Nef(131-145) A23 human epitope
              PGIRYPLTFGWCFKL Nef(131-145) A24 human epitope
              PGIRYPLTFGWCFKL Nef(131-145) B35 human epitope
              PGIRYPLTFGWCFKL Nef(131-145) human epitope
              PGIRYPLTFGWCFKL Nef(131-145) human epitope
              PGIRYPLTFGWCFKL Nef(131-145) human epitope
              PGIRYPLTFGWCFKL Nef(131-145) human epitope
              PGIRYPLTFGWCFKLVPVEP Nef(131-150) human epitope
               GIRYPLTFGWCFK Nef(132-144) human epitope
               GvRYPLTFGWCFK Nef(132-144) observed variant
               GIRYPLcFGWCFK Nef(132-144) observed variant
               GVRYPLTLGWCFKLV Nef(132-146) A24 human epitope
               GVRYPLTFGWCYKLVP Nef(132-147) A1, B8 human epitope
               GVRYPLTFGWCYKLVP Nef(132-147) B18 human epitope
               GVRYPLTFGWCYKLVP Nef(132-147) H-2d mouse epitope
               GIRYPLTFGWCFKLVP Nef(132-147) human epitope
               GVRYPLTFGWCYKLVPVEPD Nef(132-151) human epitope
                TRYPLTFGW Nef(133-141) A*03 human epitope
                TRYPLTFGW Nef(133-141) A*23 human epitope
                TRYPLTFGW Nef(133-141) A*24 human epitope
                TRYPLTFGW Nef(133-141) A*29 human epitope
                TRYPLTFGW Nef(133-141) A*33 human epitope
                TRYPLTFGW Nef(133-141) A33 human epitope
                TRYPLTFGW Nef(133-141) A33 human epitope
                TRYPLTFGW Nef(133-141) A*68:02 human epitope
                TRYPLTFGW Nef(133-141) B*18 human epitope
                VRYPLTFGW Nef(133-141) B27 human epitope
                VRYPLTFGW Nef(133-141) B*27:02 human epitope
                VRYPLTFGW Nef(133-141) B*27:05 human epitope
                TRYPLTFGW Nef(133-141) B*35:01, B*35:08 human epitope
                TRYPLTFGW Nef(133-141) B*35:02, B*35:03, B*53:01 human epitope
                TRYPLTFGW Nef(133-141) B*42:01 human epitope
                VRYPLTFGW Nef(133-141) C*04:01 human epitope
                VRYPLTFGW Nef(133-141) human epitope
                TRYPLTFGW Nef(133-141) human epitope
                VRYPLTFGW Nef(133-141) human epitope
                GRFPLTFGW Nef(133-141) human epitope
                tRyPLTFGW Nef(133-141) observed variant
                IRYPLTFGWC Nef(133-142) B*27 human epitope
                TRYPLTFGWCYKLVP Nef(133-147) A24 human epitope
                TRYPLTFGWCYKLVP Nef(133-147) B35 human epitope
                IRYPLTFGWCFKLVP Nef(133-147) human epitope
                pRYPLTFGWCFKLVP Nef(133-147) non-susceptible form; susceptible form
                VRYPLTFGWCYKLVPV Nef(133-148) B57 human epitope
                 RYPLTFGW Nef(134-141) A*23 human epitope
                 RYPLTFGW Nef(134-141) A23, A24, B35, B53 human epitope
                 RYPLTFGW Nef(134-141) A*23:01 human epitope
                 RYPLTFGW Nef(134-141) A*23:01 human epitope
                 RYPLTFGW Nef(134-141) A*23:01, A24 human epitope
                 RYPLTFGW Nef(134-141) A*23:01, A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RfPLTFGW Nef(134-141) escape documented in this paper
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RFPLTFGW Nef(134-141) A*24 human epitope
                 RyPLTFGW Nef(134-141) susceptible form
                 RyPLcFGW Nef(134-141) susceptible form
                 RyPLTlGW Nef(134-141) escape documented in this paper
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RfPLTFGW Nef(134-141) diminished HLA binding or increased off-rate; diminished response
                 RYPLcFGW Nef(134-141) diminished response
                 RYPLTlGW Nef(134-141) escape documented in this paper
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 {PGPGT}RYPLTlGW{CFKLV} Nef(134-141) non-susceptible form; observed variant
                 {PGPGT}RYPLmFGW{CFKLV} Nef(134-141) observed variant; susceptible form
                 {PGPGi}RfPLTFGW{CFKLV} Nef(134-141) observed variant; susceptible form
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RYPLmFGW Nef(134-141) escape documented in this paper; observed variant
                 RYPLTlGW Nef(134-141) escape documented in this paper; observed variant
                 RfPLTFGW Nef(134-141) escape documented in this paper; observed variant
                 RYPLTFGW Nef(134-141) A*24 human epitope
                 RYPLTFGW Nef(134-141) A24 human epitope
                 RYPLTFGW Nef(134-141) A24 human epitope
                 RYPLTFGW Nef(134-141) A24 human epitope
                 RYPLTFGW Nef(134-141) A24 human epitope
                 RYPLTFGW Nef(134-141) A24 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RfPLTFGW Nef(134-141) observed variant
                 RfPiTFGW Nef(134-141) observed variant
                 RYPiTFGW Nef(134-141) observed variant
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RfPLTFGW Nef(134-141) altered KIR binding or increased/decreased off-rate
                 RYPLTFGa Nef(134-141) susceptible form
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RfPLTFGW Nef(134-141) susceptible form
                 RYPLTlGW Nef(134-141) non-susceptible form
                 RYPLcFGW Nef(134-141) non-susceptible form
                 RfPLcFGW Nef(134-141) non-susceptible form
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RfPLTFGW Nef(134-141) TCR related mutation
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RfPLTFGW Nef(134-141) diminished HLA binding or increased off-rate
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RfPLTFGW Nef(134-141) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                 RYPLcFGW Nef(134-141) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*24:02 human epitope
                 RYPLTFGW Nef(134-141) A*29 human epitope
                 RYPLTFGW Nef(134-141) A33 human epitope
                 RYPLTFGW Nef(134-141) B*18 human epitope
                 RYPLTFGW Nef(134-141) B*27 human epitope
                 RYPLTFGW Nef(134-141) B27 human epitope
                 RYPLTFGW Nef(134-141) B27 human epitope
                 RYPLTFGW Nef(134-141) B*35:02, B*35:03, B*53:01 human epitope
                 RYPLTFGW Nef(134-141) C*04 human epitope
                 RYPLTFGW Nef(134-141) human epitope
                 RFPLTFGW Nef(134-141) human epitope
                 RyPLTFGW Nef(134-141) observed variant
                 RYPLTFGW Nef(134-141) human epitope
                 RYPLTFGWCF Nef(134-143) A*23:01 human epitope
                 RYPLTFGWCF Nef(134-143) A*23:01 human epitope
                 RYPLTFGWCF Nef(134-143) A*23:01, A*24 human epitope
                 RfPLTFGWCF Nef(134-143) altered HLA expression; observed variant
                 RYPLTFGWCF Nef(134-143) A*24 human epitope
                 RYPLTFGWCy Nef(134-143) observed variant
                 RYPLTFGWCY Nef(134-143) A*24 human epitope
                 RYPLcFGWCY Nef(134-143) observed variant
                 RYPLcFGWCf Nef(134-143) observed variant
                 RfPLcFGWCf Nef(134-143) observed variant
                 R(f)YPLcFGWCf Nef(134-143) observed variant
                 RYPLcF(a)GWCf Nef(134-143) observed variant
                 RYPLTFGWCF Nef(134-143) A*24 human epitope
                 RfPLTFGWCF Nef(134-143) diminished response
                 RYPLcFGWCF Nef(134-143) diminished response
                 RYPLTlGWCF Nef(134-143) escape documented in this paper
                 RYPLTFGWCF Nef(134-143) A*24 human epitope
                 RYPLcFGWCF Nef(134-143) subtype-specific susceptible form
                 RYPLTFGWCF Nef(134-143) A*24 human epitope
                 RYPLTFGWCF Nef(134-143) A*24 human epitope
                 RfPLTFGWCF Nef(134-143) literature escape; observed variant
                 kfPLTFGWCF Nef(134-143) observed variant
                 RYPLTlGWCF Nef(134-143) inferred escape
                 RYPLTFGWCY Nef(134-143) A*24 human epitope
                 RYPLTFGWCf Nef(134-143) observed variant
                 RYPLTFGWCY Nef(134-143) A24 human epitope
                 RYPLTFGWCY Nef(134-143) A24 human epitope
                 RYPLTFGWCF Nef(134-143) A24 human epitope
                 RYPLTFGWCY Nef(134-143) A24 human epitope
                 RYPLTFGWCY Nef(134-143) A24, B35 human epitope
                 RYPLTFGWCf Nef(134-143) observed variant
                 RfPLTFGWCf Nef(134-143) observed variant
                 RYPLTyGWCf Nef(134-143) observed variant
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCF Nef(134-143) diminished HLA binding or increased off-rate
                 RYPLTlGWCF Nef(134-143) observed variant
                 RYPLTFGWCy Nef(134-143) observed variant
                 RfPLTFGWCy Nef(134-143) observed variant
                 RYPLTFGWpF Nef(134-143) observed variant
                 RfPLTFGWpF Nef(134-143) observed variant
                 RxPLTFGWpF Nef(134-143) observed variant
                 RYPiTFGWCF Nef(134-143) observed variant
                 RfPmTFGWCF Nef(134-143) observed variant
                 RYPcTFGWCF Nef(134-143) observed variant
                 RfPcTFGWCF Nef(134-143) observed variant
                 RwPLTFGWCF Nef(134-143) observed variant
                 RYPLTFGWCY Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCY Nef(134-143) escape documented in this paper
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RFPLTFGWCF Nef(134-143) literature escape; susceptible form; TCR related mutation
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCF Nef(134-143) escape documented in this paper
                 RYPLTFGWCy Nef(134-143) observed variant
                 RYPLcFGWCF Nef(134-143) observed variant
                 RfPLcFGWCF Nef(134-143) observed variant
                 RfPLlFGWCF Nef(134-143) observed variant
                 RfPiTFGWCF Nef(134-143) observed variant
                 RYPLTFGWpF Nef(134-143) observed variant
                 RlPLTFGWCF Nef(134-143) observed variant
                 RfPLTFGWsF Nef(134-143) observed variant
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCF Nef(134-143) inferred escape; literature escape; replicative capacity reduced
                 RYPiTFGWCF Nef(134-143) observed variant
                 RfPiTFGWCF Nef(134-143) observed variant
                 RfPLcFGWCF Nef(134-143) observed variant
                 RYPLcFGWCF Nef(134-143) inferred escape; literature escape
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCY Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCF Nef(134-143) escape documented in this paper; observed variant
                 RfPLcFGWCF Nef(134-143) escape documented in this paper; observed variant
                 RlPLTFGWCF Nef(134-143) observed variant
                 RwPLTFGWCF Nef(134-143) observed variant
                 RYPLTFGWCy Nef(134-143) observed variant
                 RYPLTlGWCF Nef(134-143) observed variant
                 RYPLTlGWCy Nef(134-143) observed variant
                 RYPLTFGWpF Nef(134-143) observed variant
                 RYPLcFGWCF Nef(134-143) observed variant
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCF Nef(134-143) escape documented in this paper; processing
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCY Nef(134-143) A*24:02 human epitope
                 RYPLCFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLtFGWCF Nef(134-143) subtype-specific susceptible form
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLcFGWCF Nef(134-143) subtype-specific susceptible form
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCF Nef(134-143) observed variant
                 RfPiTFGWCF Nef(134-143) observed variant
                 RYPiTFGWCF Nef(134-143) observed variant
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RfPLTFGWCF Nef(134-143) TCR related mutation
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                 RYPLTFGWCF Nef(134-143) B*35 human epitope
                 RYPLTFGWCY Nef(134-143) C*07 human epitope
                 RYPLTFGWCY Nef(134-143) C*07:02 human epitope
                 RYPLTFGWCY Nef(134-143) C*07:02 human epitope
                 RYPLTFGWCf Nef(134-143) HLA binding unchanged
                 RYPLTFGWC- Nef(134-143) diminished HLA binding or increased off-rate
                 RfPLTFGWCY Nef(134-143) diminished HLA binding or increased off-rate
                 RlPLTFGWCY Nef(134-143) diminished HLA binding or increased off-rate
                 --PLTFGWCf{kl} Nef(134-143) diminished HLA binding or increased off-rate
                 RYPLTFGWCF Nef(134-143) human epitope
                 RYPLTFGWCF Nef(134-143) human epitope
                 RYPLTFGWCF Nef(134-143) human epitope
                 --PLTFGWCyKL Nef(134-143) HLA association; susceptible form
                 -fPLTFGWCG Nef(134-143) HLA association; susceptible form
                 -YPLTFGWCy Nef(134-143) HLA association; susceptible form
                 {t}RYPLTFGW Nef(134-143) HLA association; susceptible form
                 RYPLTFGWCYK Nef(134-144) B18 human epitope
                 RYPLTFGWCYK Nef(134-144) B18 human epitope
                 RYPLcFGWCYK Nef(134-144) escape documented in this paper
                 RYPLTFGWCFKLVPV Nef(134-148) human epitope
                 RYPLTFGWCFKLVPV Nef(134-148) human epitope
                  YPLTFGWCF Nef(135-143) A2 human epitope
                  YPLTFGWCF Nef(135-143) A*23 human epitope
                  YPLTFGWCY Nef(135-143) A*23 human epitope
                  YPLTFGWCF Nef(135-143) A*24 human epitope
                  FPLTFGWCF Nef(135-143) A*24:02 human epitope
                  YPLTFGWCY Nef(135-143) B*07, B*35 human epitope
                  YPLTFGWCY Nef(135-143) B*07:02 human epitope
                  YPLTFGWCY Nef(135-143) B*07:02 human epitope
                  YPLTFGWCF Nef(135-143) B*07:02, B*18:01 human epitope
                  YPLTFGWCY Nef(135-143) B*18 human epitope
                  YPLTFGWCY Nef(135-143) B*18 human epitope
                  YPLTFGWCF Nef(135-143) B*18 human epitope
                  YPLTFGWCF Nef(135-143) B*18 human epitope
                  YPLTFGWCF Nef(135-143) B*18 human epitope
                  YPLTFGWCF Nef(135-143) B*18, B*35 human epitope
                  YPLTFGWCF Nef(135-143) B18 human epitope
                  YPLTFGWCY Nef(135-143) B18 human epitope
                  YPLTFGWCY Nef(135-143) B18 human epitope
                  YPLTFGWCY Nef(135-143) B18 human epitope
                  YPLTFGWCY Nef(135-143) B18 human epitope
                  YPLTFGWCY Nef(135-143) B18 human epitope
                  YPLTFGWCY Nef(135-143) B18 human epitope
                  YPLTFGWCF Nef(135-143) B18 human epitope
                  YPLTFGWCF Nef(135-143) B18, B35 human epitope
                  fPLTFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                  YPLcFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                  fPLcFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                  YPLTFGWCy Nef(135-143) susceptible form; subtype-specific susceptible form
                  YPLTlGWCF Nef(135-143) non-susceptible form; susceptible form; subtype-specific non-susceptible form
                  YPLTFGWCY Nef(135-143) B18, B35, B49, B53, B7 human epitope
                  YPLTFGWCf Nef(135-143) susceptible form
                  YPLTFGWCF Nef(135-143) B*53:01, B18, B35 human epitope
                  YPLTFGWCY Nef(135-143) B18, B49 human epitope
                  YPLTFGWCf Nef(135-143) susceptible form
                  YPLTFGWCY Nef(135-143) B18, B53, B7 human epitope
                  YPLTFGWCf Nef(135-143) observed variant
                  fPLTFGWCf Nef(135-143) observed variant
                  YPLTyGWCf Nef(135-143) observed variant
                  YPLTFGWCF Nef(135-143) B*53:01, B18 human epitope
                  YPLTFGWCY Nef(135-143) B*18:01 human epitope
                  YPLTFGWCY Nef(135-143) B*18:01 human epitope
                  YPLTGWCF Nef(135-143) B*18:01 human epitope
                  YPLTFGWCF Nef(135-143) B*18:01 human epitope
                  YPLTFGWCF Nef(135-143) B*18:01 human epitope
                  YPLTFGWCF Nef(135-143) B*35 human epitope
                  YPLTFGWCF Nef(135-143) B*35 human epitope
                  YPLTFGWCY Nef(135-143) B*35 human epitope
                  fPLTFGWCY Nef(135-143) observed variant
                  YPLTlGWCY Nef(135-143) escape documented in this paper
                  YPLcFGWCY Nef(135-143) escape documented in this paper
                  YPLTFGWCF Nef(135-143) B*35 human epitope
                  YPLTFGWCY Nef(135-143) B*35 human epitope
                  YPLTFGWCF Nef(135-143) B*35 human epitope
                  YPLcFGWCF Nef(135-143) subtype-specific susceptible form
                  YPLTFGWCY Nef(135-143) B*35, B*53:01 human epitope
                  YPLTFGWCY Nef(135-143) B35 human epitope
                  YPLTFGWCF Nef(135-143) B35 human epitope
                  YPLTFGWCY Nef(135-143) B35 human epitope
                  YPLTFGWCY Nef(135-143) B35 human epitope
                  YPLTFGWCF Nef(135-143) B35 human epitope
                  YPLTFGWCF Nef(135-143) B*35:01 human epitope
                  fPLTFGWCF Nef(135-143) observed variant; replicative capacity reduced
                  lPLTFGWCF Nef(135-143) observed variant; replicative capacity is not abrogated; susceptible form
                  YPLTFGWCY Nef(135-143) B*35:01 human epitope
                  YPLTFGWCF Nef(135-143) B*35:01 human epitope
                  YPLTFGWCY Nef(135-143) B*35:01, B*35:08 human epitope
                  YPLTFGWCF Nef(135-143) B*35:01, B*53:01 human epitope
                  YPLTFGWCF Nef(135-143) B*35:02, B*35:03, B*53:01 human epitope
                  YPLTFGWCY Nef(135-143) B*35:02, B*35:03, B*53:01 human epitope
                  YPLTFGWCY Nef(135-143) B*49 human epitope
                  YPLTFGWCY Nef(135-143) B49 human epitope
                  YPLTFGWCf Nef(135-143) observed variant
                  YLPTFGWCY Nef(135-143) B49 human epitope
                  YLPTFGWCf Nef(135-143) observed variant
                  YPLTFGWCY Nef(135-143) B49 human epitope
                  YPLTFGWCY Nef(135-143) B49 human epitope
                  YPLTFGWCF Nef(135-143) B*53 human epitope
                  YPLTFGWCF Nef(135-143) B*53 human epitope
                  YPLTFGWCF Nef(135-143) B53 human epitope
                  YPLTFGWCY Nef(135-143) B53 human epitope
                  YPLTFGWCF Nef(135-143) B*53:01 human epitope
                  YPLTFGWCY Nef(135-143) B*53:01 human epitope
                  YPLTFGWCF Nef(135-143) B*53:01 human epitope
                  YPLTFGWCY Nef(135-143) B*53:01 human epitope
                  YPLTFGWCF Nef(135-143) B*53:01 human epitope
                  YPLTFGWCY Nef(135-143) B*53:01 human epitope
                  YPLTFGWCF Nef(135-143) B*53:01 human epitope
                  YPLTFGWCF Nef(135-143) B*57 human epitope
                  YPLTFGWCF Nef(135-143) B*58:01 human epitope
                  YPLTFGWCF Nef(135-143) B*67:01 human epitope
                  YPLTFGWCF Nef(135-143) B7 human epitope
                  YPLTFGWCY Nef(135-143) B7 human epitope
                  YPLTFGWCY Nef(135-143) B7 supertype human epitope
                  YPLTFGWCF Nef(135-143) C*02 human epitope
                  YPLTFGWCF Nef(135-143) C*04 human epitope
                  YPLTFGWCY Nef(135-143) C*07:02 human epitope
                  YPLTFGWCF Nef(135-143) human epitope
                  YPLTFGWCY Nef(135-143) human epitope
                  YPLTFGWCY Nef(135-143) human epitope
                  YPLTFGWCY Nef(135-143) human epitope
                  YPLTFGWCFKLVPV Nef(135-148) human epitope
                  YPLTFGWCFKLVPV Nef(135-148) human epitope
                   PLTFGWCYK Nef(136-144) A3 human epitope
                   PLTFGWCYKL Nef(136-145) A*02 human epitope
                   PLTFGWCYKL Nef(136-145) A*02 human epitope
                   PLTFGWCFKL Nef(136-145) A*02 human epitope
                   PLTFGWCYKL Nef(136-145) A*02 human epitope
                   PLcFGWCfKL Nef(136-145) subtype-specific non-susceptible form
                   PLTFGWCYKL Nef(136-145) A*02 human epitope
                   PLcFGWCfKL Nef(136-145) observed variant
                   PLcF(a)GWCfKL Nef(136-145) observed variant
                   PLTFGWCYKL Nef(136-145) A*02 human epitope
                   PLTFGWCYKL Nef(136-145) A*02 human epitope
                   PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                   PLTFGWCFKL Nef(136-145) A*02:01 transgenic mouse epitope
                   PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                   PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                   PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                   PLTFGWCYKL Nef(136-145) A2 human epitope
                   PLTFGWCYKL Nef(136-145) A2 human epitope
                   PLTFGWCYKL Nef(136-145) A2 human epitope
                   PLTFGWCFKL Nef(136-145) A2 human epitope
                   PLTFGWCYKL Nef(136-145) A2 human epitope
                   PLTFGWCYKL Nef(136-145) A*32 human epitope
                   PLTFGWCYKL Nef(136-145) B*07 human epitope
                   PLTFGWCYKL Nef(136-145) B*18 human epitope
                   PLTFGWCYKL Nef(136-145) B*35:02, B*35:03, B*53:01 human epitope
                   PLTFGWCYKL Nef(136-145) B*49 human epitope
                   PLTFGWCYKL Nef(136-145) B*58:01 human epitope
                   PLTFGWCYKL Nef(136-145) C*14 human epitope
                   PLTFGWCYKL Nef(136-145) human epitope
                   PLTFGWCFKL Nef(136-145) human epitope
                   PLTFGWCyKL Nef(136-145) observed variant
                   PLTFGWCFKL Nef(136-145) human epitope
                   PLTLGWCFKL Nef(136-145) observed variant
                   PITFGWCFKL Nef(136-145) susceptible form
                   PVTFGWCFKL Nef(136-145) susceptible form
                   PLCFGWCFKL Nef(136-145) susceptible form
                   PVCFGWCFKL Nef(136-145) observed variant
                   PMCFGWCFKL Nef(136-145) susceptible form
                   PLCFGWCFKP Nef(136-145) susceptible form
                   PLTFGWCFKL Nef(136-145) human epitope
                   PLTFGWCYKLV Nef(136-146) A*02:01 human epitope
                    LTFGWCFKL Nef(137-145) A*02 human epitope
                    LTFGWCFKL Nef(137-145) A*02:01 human epitope
                    LTFGWCFKL Nef(137-145) A*02:01 human epitope
                    LTFGWCFKL Nef(137-145) A*02:01 human epitope
                    LTFGWCFKL Nef(137-145) A*02:01 mouse epitope
                    LTFGWCFKL Nef(137-145) A2 human epitope
                    LTFGWCFKL Nef(137-145) A2 human epitope
                    LTFGWCFKL Nef(137-145) A2 human epitope
                    LTFGWCFKL Nef(137-145) A2 human epitope
                    LTFGWCYKL Nef(137-145) A2 human epitope
                    LTFGWCFKL Nef(137-145) A*23 human epitope
                    LTFGWCFKL Nef(137-145) A*25 human epitope
                    LTFGWCFKL Nef(137-145) A2 supertype human epitope
                    LTFGWCFKL Nef(137-145) A2 supertype human epitope
                    LTFGWCFKL Nef(137-145) A*32 human epitope
                    LTFGWCFKL Nef(137-145) A*68:02 human epitope
                    LTFGWCFKL Nef(137-145) A*80 human epitope
                    LTFGWCFKL Nef(137-145) B*15:17, B57 human epitope
                    LTFGWCFKL Nef(137-145) B*15:40 human epitope
                    LTFGWCFKL Nef(137-145) B*57 human epitope
                    LTFGWCFKL Nef(137-145) B*57 human epitope
                    LTFGWCFKL Nef(137-145) B*63 human epitope
                    LTFGWCFKL Nef(137-145) C*14 human epitope
                    LTFGWCFKL Nef(137-145) human epitope
                    LTFGWCFKL Nef(137-145) human epitope
                    LTFGWCFKL Nef(137-145) human epitope
                    LTFGWCFKL Nef(137-145) human epitope
                    LTFGWCFKLV Nef(137-146) A2 human epitope
                    LTFGWCFKLV Nef(137-146) A2 human epitope
                    LTFGWCFKLV Nef(137-146) A2 human epitope
                    LTFGWCFKLV Nef(137-146) A2 human epitope
                    LTFGWCFKLV Nef(137-146) A2 human epitope
                    LTFGWCFKLV Nef(137-146) A2 human epitope
                    LTFGWCFKLV Nef(137-146) A*23 human epitope
                    LTFGWCFKLV Nef(137-146) A2 supertype human epitope
                    LTFGWCFKLV Nef(137-146) A*32 human epitope
                    LTFGWCFKLV Nef(137-146) A*68:02 human epitope
                    LTFGWCFKLV Nef(137-146) A*80 human epitope
                    LTFGWCFKLV Nef(137-146) B*15:17 human epitope
                    LTFGWCYKLV Nef(137-146) human epitope
                    LTFGWCFKLVPVEPEKVE Nef(137-154) human epitope
                        WCFKLVPV Nef(141-148) A2 human epitope
                        WCFKLVPV Nef(141-148) A2 human epitope
                        WCyKLVPV Nef(141-148) observed variant
                        WCFKLVPV Nef(141-148) A2 human, transgenic mouse epitope
                         CYKLVPVEPDKVEEANKGEN Nef(142-161) human epitope
                          FKLVPVDPEEVEEAN Nef(143-157) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Copyright Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services LANL logo National Institutes of Health logo