HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

LWIYHTQGYFPDWQNYTPGPGV Nef(112-133) human epitope
LWIYHTQGYFPDWQNYTPGPGV Nef(112-133) human epitope
LWIYHTQGYFPDWQNYTPGPGV Nef(112-133) human epitope
 WIYHTQGYFPDWQNYT Nef(113-128) A*01 human epitope
 WIYHTQGYFPDWQNYT Nef(113-128) A1 human epitope
 WVHHTQGYFPDWQNYT Nef(113-128) human epitope
   YHTQGYFPDWQNYTP Nef(115-129) human epitope
    HTQGYFPDWQNYTPG Nef(116-130) human epitope
    HTQGYFPDWQNYTPG Nef(116-130) human epitope
    HTQGYFPDWQNYTPG Nef(116-130) human epitope
     TQGYFPDWQNYT Nef(117-128) B17, B37 human epitope
     TQGYFPDWQNYT Nef(117-128) human epitope
     TQGYFPDWQNYTPGP Nef(117-131) B57 human epitope
     TQGYFPDWQNYTPGP Nef(117-131) human epitope
     TQGYFPDWQNYTPGP Nef(117-131) human epitope
     TQGYFPDWQNYTPGPGVRYPLTFGWCYKLVP Nef(117-147) human epitope
      QGYFPDWQNYTPGPGVRY Nef(118-135) C*16 human epitope
      QGYFPDWQNYTPGPGIRY Nef(118-135) human epitope
      QGYFPDWQNYTPGPGRF Nef(118-135) human epitope
      QGYFPDWQNYTPGPvRy Nef(118-135) subtype-specific susceptible form
      QGYFPDWQNYTPGPGIRY Nef(118-135) human epitope
        YFPDWQNYT Nef(120-128) A*01 human epitope
        YFPDWQNYT Nef(120-128) A1 human epitope
        YFPDWQNYT Nef(120-128) A1 human epitope
        YFPDWQNYT Nef(120-128) A1 human epitope
        YFPDWQNYT Nef(120-128) A1 human epitope
        YFPDWQNYT Nef(120-128) A1 human epitope
        YFPDWQNYT Nef(120-128) A1 human epitope
        YFPDWQNYT Nef(120-128) A1 human epitope
        YFPDWQNYT Nef(120-128) A1, A29 human epitope
        YFPDWQNYT Nef(120-128) A1, B*3701, B*5701 human epitope
        YFPDWQNYT Nef(120-128) A*29 human epitope
        YFPDWQNYT Nef(120-128) A*29 human epitope
        YFPDWQNYT Nef(120-128) A29, B*3501, Cw6 human epitope
        FFPDWKNYT Nef(120-128) B15 human epitope
        lFPDWKNYT Nef(120-128) escape documented in this paper
        YFPDWQNYT Nef(120-128) B*18 human epitope
        YFPDWQNYT Nef(120-128) B*37 human epitope
        YFPDWQNYT Nef(120-128) B37, B57 human epitope
        YFPDWQNYT Nef(120-128) B37, B57 human epitope
        YFPDWQNYT Nef(120-128) B*49 human epitope
        YFPDWQNYT Nef(120-128) B*51 human epitope
        FFPDWKNYT Nef(120-128) B51 human epitope
        yFPDWqNYT Nef(120-128) escape documented in this paper
        yFPDWhNYT Nef(120-128) escape documented in this paper
        yFPDWqsYT Nef(120-128) escape documented in this paper
        ylPDWqsYT Nef(120-128) escape documented in this paper
        yFPDWdNYT Nef(120-128) escape documented in this paper
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B*57 human epitope
        YFPDWQNYT Nef(120-128) B57 human epitope
        YFPDWQDYT Nef(120-128) B57 human epitope
        YFPDWQNYT Nef(120-128) B57 human epitope
        YFPDWQNYT Nef(120-128) B*5801, B57 human epitope
        YFPDWQNYT Nef(120-128) B57, B63 human epitope
        YFPDWQNYT Nef(120-128) B*5701 human epitope
        YFPDWQcYT Nef(120-128) observed variant
        YFPDWQchT Nef(120-128) observed variant
        YFPDWQNYT Nef(120-128) B58 human epitope
        YFPDWQNYT Nef(120-128) C*01 human epitope
        YFPDWQNYT Nef(120-128) C*06 human epitope
        YFPDWQNYT Nef(120-128) C*14 human epitope
        YFPDWQNYT Nef(120-128) Cw*06 human epitope
        YFPDWQDYT Nef(120-128) human epitope
        YFPDWQNYT Nef(120-128) human epitope
        YFPDWQNYT Nef(120-128) human epitope
        YFPDWQNYTP Nef(120-129) B*57 human epitope
        YFPDWQNYTPGPGIR Nef(120-134) human epitope
        YFPDWQNYTPGPGIRYPLTFGWCYK Nef(120-144) A24 human epitope
         FPDWQNYT Nef(121-128) A*01 human epitope
         FPDWhNYT Nef(121-128) observed variant
         FPDWQyYT Nef(121-128) observed variant
         FPeWgNYT Nef(121-128) observed variant
         FPDWQNYT Nef(121-128) A*01 human epitope
         FPDWQNYT Nef(121-128) A1 human epitope
         FPDWQNYTP Nef(121-129) B*5401 human epitope
         FPDWQNYTP Nef(121-129) B*5401 human epitope
         FPDWQNYTPGPGIRY Nef(121-135) A*0201 human epitope
         FPDWQNYTPGPGIRY Nef(121-135) A24 human epitope
         FPDWQNYTPGPGIRY Nef(121-135) human epitope
          PDWQNYTPGPGVRYP Nef(122-136) human epitope
          PDWQNYTPGPGVRYPLTFGW Nef(122-141) B*35 human epitope
          PDWQNYTPGPGVRYPLTFGW Nef(122-141) human epitope
           QWQNYTPGPGVRYPL Nef(123-137) human epitope
            WQNYTPGPGIRYPLT Nef(124-138) human epitope
            WQNYTPGPGIRYPLT Nef(124-138) human epitope
             QNYTPGPGIRYPLTF Nef(125-139) A*0201 human epitope
             QNYTPGPGVRYPLTF Nef(125-139) human epitope
             QNYTPGPGRFPLTFGWCF Nef(125-143) human epitope
             QNYTPGPGvRyPLTFGWCF Nef(125-143) subtype-specific susceptible form
              NYTPGPGVRY Nef(126-135) A24 human epitope
              NYTPGPGIRY Nef(126-135) A*2402 human epitope
              NYTPGPGIRY Nef(126-135) A*2402 human epitope
              NYTPGPGvRY Nef(126-135) observed variant
              cYTPGPGtRY Nef(126-135) observed variant
              NYTPGPGtRY Nef(126-135) observed variant
              NYTPGPGIRf Nef(126-135) observed variant
              NYTPGPGtRf Nef(126-135) observed variant
              cYTPGPGIRf Nef(126-135) observed variant
              gYTPGPGIRf Nef(126-135) observed variant
              cYTPGPGtRf Nef(126-135) observed variant
              gYTPGPGtRf Nef(126-135) observed variant
              NYTPGPGvRf Nef(126-135) observed variant
              NYTPGPGeRf Nef(126-135) observed variant
              NYTPGPGvRl Nef(126-135) observed variant
              NYTPGPGtRw Nef(126-135) observed variant
              NYTPGPGVRYPLT Nef(126-138) B7 human epitope
              NYTPGPGTRYPLTFG Nef(126-140) A24 human epitope
              NYTPGPGTRYPLTFG Nef(126-140) B35 human epitope
              NYTPGPGTRYPLTFG Nef(126-140) human epitope
              NYTPGPGVRYPLTFGWCF Nef(126-143) C*14 human epitope
              NYTPGPGIRYPLTFGWCF Nef(126-143) human epitope
              NYTPGPGIRYPLTFGWCF Nef(126-143) human epitope
              NYTPGPGIRYPLCFGWCF Nef(126-143) human epitope
               YTPGPGIRY Nef(127-135) A*23 human epitope
               YTPGPGIRY Nef(127-135) A*24 human epitope
               YTPGPGIRY Nef(127-135) B*3502, B*3503, B*5301 human epitope
               YTPGPGIRY Nef(127-135) B*57 human epitope
               YTPGPGIRY Nef(127-135) B*57 human epitope
               YTPGPGIRY Nef(127-135) B57, B58 human epitope
               YTPGPGVRY Nef(127-135) B*5801 human epitope
               YTPGPGIRY Nef(127-135) B*63 human epitope
               YTPGPGTRY Nef(127-135) human epitope
               YTPGPGIRY Nef(127-135) human epitope
               YTPGPGVRY Nef(127-135) human epitope
               YTPGPGVRYPLTFGW Nef(127-141) A24 human epitope
               YTPGPGVRYPLTFGW Nef(127-141) B35 human epitope
               YTPGPGVRYPLTFGW Nef(127-141) human epitope
                TPGPGVRY Nef(128-135) B*0702 human epitope
                TPGPGVRY Nef(128-135) B7 supertype human epitope
                TPGPGVRYP Nef(128-136) B*07 human epitope
                TPGPGVRYPL Nef(128-137) B*07 human epitope
                TPGPGVRYPL Nef(128-137) B*07 human epitope
                TPGPGVRYPL Nef(128-137) B*07 human epitope
                TPGPGVRYPL Nef(128-137) B*07 human epitope
                TPGPGVRYPL Nef(128-137) B*07 human epitope
                TPGPGVRYPL Nef(128-137) B*07 human epitope
                TPGPGVRYPL Nef(128-137) B*07 human epitope
                TPGPGVKYPL Nef(128-137) B*07 human, transgenic mouse epitope
                TPGPGiKYPL Nef(128-137) susceptible form
                TPGPGVRYPL Nef(128-137) B*07, B*42 human epitope
                TPGPGVRYPL Nef(128-137) B*0702 human epitope
                TPGPGTRYPL Nef(128-137) B*0702 human epitope
                TPGPGiRYPL Nef(128-137) non-susceptible form
                TPGPGvRYPL Nef(128-137) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                TPGPGTRfPL Nef(128-137) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                TPGPGIRYPL Nef(128-137) B*0702 human epitope
                TPGPGvRYPL Nef(128-137) susceptible form
                TPGPGVRYPL Nef(128-137) B*0702 human epitope
                TPGPGVRYPL Nef(128-137) B*0702 human epitope
                TPGPGVRYPL Nef(128-137) B*0702 human epitope
                TPGPGVRYPL Nef(128-137) B*0702 human epitope
                TPGPGIRYPL Nef(128-137) B*0702 human epitope
                TPGPGvRYPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                TPGPGvRfPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                TPGPGvRwPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                TPGPGvRlPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                TPGPGtRfPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                TPGPGIRYPL Nef(128-137) B*0702 human epitope
                TPGPGvRYPL Nef(128-137) subtype-specific susceptible form
                TPGPGVRYPL Nef(128-137) B*0702 human epitope
                TPGPGVRYPL Nef(128-137) B*0702, B*4201 human epitope
                TPGPGVRYPL Nef(128-137) B*0702, B7 human epitope
                TPGPGVRYPL Nef(128-137) B35 human epitope
                TPGPGTRYPL Nef(128-137) B35 human epitope
                TPGPGvRYPL Nef(128-137) susceptible form
                TPGPGVRYPL Nef(128-137) B35 human epitope
                TPGPGVRYPL Nef(128-137) B*3502, B*3503, B*5301 human epitope
                TPGPGVRYPL Nef(128-137) B*42 human epitope
                TPGPGIRYPL Nef(128-137) B42 human epitope
                TPGPGVRYPL Nef(128-137) B*4201 human epitope
                TPGPGVRYPL Nef(128-137) B*4201 human epitope
                TPGPGVRYPL Nef(128-137) B*4201 human epitope
                TPGPGVRYPL Nef(128-137) B*4201 human epitope
                TPGPGVRYPL Nef(128-137) B*4201 human epitope
                TPGPGVRYPL Nef(128-137) B*4201 human epitope
                TsGPGVRYPL Nef(128-137) diminished HLA binding or increased off-rate; escape documented in this paper
                TqGPGVRYPL Nef(128-137) diminished HLA binding or increased off-rate; escape documented in this paper
                TPGPGVRYPL Nef(128-137) B*4201, B*4202 human epitope
                TPGPGVRYPL Nef(128-137) B*4202 epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human, macaque epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGiRYPL Nef(128-137) susceptible form
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGiRYPL Nef(128-137) observed variant
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGiRYPL Nef(128-137) observed variant
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 human epitope
                TPGPGIRYPL Nef(128-137) B7 human epitope
                TPGPGVRYPL Nef(128-137) B*8101, B7 human epitope
                TPGPGVRYPL Nef(128-137) B*8101, B7 human epitope
                TPGPGVRYPL Nef(128-137) B7 supertype human epitope
                TPGPGVRYPL Nef(128-137) B*8101 human epitope
                TPGPGVRYPL Nef(128-137) C*17 human epitope
                TPGPGTRYPL Nef(128-137) human epitope
                TPGPGIRFPL Nef(128-137) susceptible form
                TPGPGIRYPL Nef(128-137) susceptible form
                TPGPGIRYPV Nef(128-137) susceptible form
                TPGPGIRFPI Nef(128-137) susceptible form
                TSGPGTRFPL Nef(128-137) susceptible form
                IPGPG-RHPL Nef(128-137) observed variant
                TPGPGVRYPL Nef(128-137) observed variant
                TPGPGPRYPL Nef(128-137) susceptible form
                TPGPGTRFPL Nef(128-137) observed variant
                TPGPGPRFPL Nef(128-137) observed variant
                TPGPGIRYPM Nef(128-137) susceptible form
                TPGPGPRYPV Nef(128-137) susceptible form
                TPGPGPRYPM Nef(128-137) susceptible form
                TKGPGIRFPL Nef(128-137) susceptible form
                TPGPGPRYPM Nef(128-137) susceptible form
                TPGPGIRYPL Nef(128-137) human epitope
                TPGPGvRYPL Nef(128-137) HLA association; susceptible form
                TPGPGVRYPL Nef(128-137) human epitope
                TPGPGIRYPL Nef(128-137) human epitope
                TPGPGRFPL Nef(128-137) human epitope
                TPGPGvryPL Nef(128-137) observed variant
                TPGPGIRYPLTFGW Nef(128-141) human epitope
                TPGPGIRYPLTFGW Nef(128-141) human epitope
                TPGPGIRYPLTFGW Nef(128-141) human epitope
                 PGPGTRFPLTFGWCF Nef(129-143) A23 human epitope
                 PGPGTRFPLTFGWCF Nef(129-143) A24 human epitope
                 PGPGTRFPLTFGWCF Nef(129-143) B35 human epitope
                 PGPGIRYPLCFGWCF Nef(129-143) B35 human epitope
                 PGPGIRYPLTFGWCF Nef(129-143) B57 human epitope
                 PGPGIRYPLTFGWCF Nef(129-143) human epitope
                 PGPGpRYPLTFGWCF Nef(129-143) non-susceptible form; susceptible form
                 PGPGIRYPLTFGWCF Nef(129-143) human epitope
                 PGPGtRfPLTFGWCF Nef(129-143) observed variant
                 PGPGT|RYPLTFGW|CFKLV Nef(129-146) A*24 human epitope
                 PGPGT|RYPLTlGW|CFKLV Nef(129-146) non-susceptible form; observed variant
                 PGPGT|RYPLmFGW|CFKLV Nef(129-146) observed variant; susceptible form
                 PGPGi|RfPLTFGW|CFKLV Nef(129-146) observed variant; susceptible form
                 PGPGVRYPLTFGWCFKLV Nef(129-146) human epitope
                 PGPGVRYPLTFGWCFKLVP Nef(129-147) human epitope
                  GPGVRYPLTF Nef(130-139) B35 human epitope
                  GPGVRYPLTF Nef(130-139) B35 human epitope
                  GPGTRFPLTR Nef(130-139) B7 human epitope
                  GPGVRYPLTFGWCY Nef(130-143) B*57 human epitope
                  GPGIRYPLTFGWCF Nef(130-143) B*57 human epitope
                  GPGVRYPLTFGWCY Nef(130-143) B*57 human epitope
                  GPGVRYPLTFGWCY Nef(130-143) B57 human epitope
                  GPGIRYPLTFGWCF Nef(130-143) B*5801, B57 human epitope
                  GPGVRYPLTFGWCYK Nef(130-144) human epitope
                   PGIRYPLTFGWCFKL Nef(131-145) A23 human epitope
                   PGIRYPLTFGWCFKL Nef(131-145) A24 human epitope
                   PGIRYPLTFGWCFKL Nef(131-145) B35 human epitope
                   PGIRYPLTFGWCFKL Nef(131-145) human epitope
                   PGIRYPLTFGWCFKL Nef(131-145) human epitope
                   PGIRYPLTFGWCFKL Nef(131-145) human epitope
                   PGIRYPLTFGWCFKL Nef(131-145) human epitope
                    GIRYPLTFGWCFK Nef(132-144) human epitope
                    GvRYPLTFGWCFK Nef(132-144) observed variant
                    GIRYPLcFGWCFK Nef(132-144) observed variant
                    GVRYPLTLGWCFKLV Nef(132-146) A24 human epitope
                    GVRYPLTFGWCYKLVP Nef(132-147) A1, B8 human epitope
                    GVRYPLTFGWCYKLVP Nef(132-147) B18 human epitope
                    GVRYPLTFGWCYKLVP Nef(132-147) H-2d mouse epitope
                    GIRYPLTFGWCFKLVP Nef(132-147) human epitope
                    GVRYPLTFGWCYKLVPVEPD Nef(132-151) human epitope
                     TRYPLTFGW Nef(133-141) A*03 human epitope
                     TRYPLTFGW Nef(133-141) A*23 human epitope
                     TRYPLTFGW Nef(133-141) A*24 human epitope
                     TRYPLTFGW Nef(133-141) A*29 human epitope
                     TRYPLTFGW Nef(133-141) A*33 human epitope
                     TRYPLTFGW Nef(133-141) A33 human epitope
                     TRYPLTFGW Nef(133-141) A*6802 human epitope
                     TRYPLTFGW Nef(133-141) B*18 human epitope
                     VRYPLTFGW Nef(133-141) B27 human epitope
                     TRYPLTFGW Nef(133-141) B*3501, B*3508 human epitope
                     TRYPLTFGW Nef(133-141) B*3502, B*3503, B*5301 human epitope
                     TRYPLTFGW Nef(133-141) B*4201 human epitope
                     VRYPLTFGW Nef(133-141) Cw*0401 human epitope
                     IRYPKTFGW Nef(133-141) Mamu B*17 macaque epitope
                     IRYPKTFGW Nef(133-141) Mamu B*17 macaque epitope
                     GRFPLTFGW Nef(133-141) human epitope
                     tRyPLTFGW Nef(133-141) observed variant
                     IRYPLTFGWC Nef(133-142) B*27 human epitope
                     TRYPLTFGWCYKLVP Nef(133-147) A24 human epitope
                     TRYPLTFGWCYKLVP Nef(133-147) B35 human epitope
                     IRYPLTFGWCFKLVP Nef(133-147) human epitope
                     pRYPLTFGWCFKLVP Nef(133-147) non-susceptible form; susceptible form
                     VRYPLTFGWCYKLVPV Nef(133-148) B57 human epitope
                      RYPLTFGW Nef(134-141) A*23 human epitope
                      RYPLTFGW Nef(134-141) A23, A24, B35, B53 human epitope
                      RYPLTFGW Nef(134-141) A*2301 human epitope
                      RYPLTFGW Nef(134-141) A*2301 human epitope
                      RYPLTFGW Nef(134-141) A*2301, A24 human epitope
                      RYPLTFGW Nef(134-141) A*2301, A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*24 human epitope
                      RYPLTFGW Nef(134-141) A*24 human epitope
                      RYPLTFGW Nef(134-141) A*24 human epitope
                      RYPLmFGW Nef(134-141) escape documented in this paper; observed variant
                      RYPLTlGW Nef(134-141) escape documented in this paper; observed variant
                      RfPLTFGW Nef(134-141) escape documented in this paper; observed variant
                      RYPLTFGW Nef(134-141) A*24 human epitope
                      RYPLTFGW Nef(134-141) A24 human epitope
                      RYPLTFGW Nef(134-141) A24 human epitope
                      RYPLTFGW Nef(134-141) A24 human epitope
                      RYPLTFGW Nef(134-141) A24 human epitope
                      RYPLTFGW Nef(134-141) A24 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RfPLTFGW Nef(134-141) altered KIR binding or increased/decreased off-rate
                      RYPLTFGa Nef(134-141) susceptible form
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RfPLTFGW Nef(134-141) observed variant
                      RfPiTFGW Nef(134-141) observed variant
                      RYPiTFGW Nef(134-141) observed variant
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RfPLTFGW Nef(134-141) TCR related mutation
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RfPLTFGW Nef(134-141) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                      RYPLcFGW Nef(134-141) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RfPLTFGW Nef(134-141) diminished HLA binding or increased off-rate
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RfPLTFGW Nef(134-141) susceptible form
                      RYPLTlGW Nef(134-141) non-susceptible form
                      RYPLcFGW Nef(134-141) non-susceptible form
                      RfPLcFGW Nef(134-141) non-susceptible form
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*2402 human epitope
                      RYPLTFGW Nef(134-141) A*29 human epitope
                      RYPLTFGW Nef(134-141) A33 human epitope
                      RYPLTFGW Nef(134-141) B*18 human epitope
                      RYPLTFGW Nef(134-141) B*27 human epitope
                      RYPLTFGW Nef(134-141) B27 human epitope
                      RYPLTFGW Nef(134-141) B27 human epitope
                      RYPLTFGW Nef(134-141) B*3502, B*3503, B*5301 human epitope
                      RYPLTFGW Nef(134-141) C*04 human epitope
                      RFPLTFGW Nef(134-141) human epitope
                      RyPLTFGW Nef(134-141) observed variant
                      RYPLTFGWCF Nef(134-143) A11 human epitope
                      RYPLTFGWCF Nef(134-143) A*2301 human epitope
                      RYPLTFGWCF Nef(134-143) A*2301 human epitope
                      RYPLTFGWCF Nef(134-143) A*2301, A*24 human epitope
                      RfPLTFGWCF Nef(134-143) altered HLA expression; observed variant
                      RYPLTFGWCY Nef(134-143) A*24 human epitope
                      RYPLcFGWCY Nef(134-143) observed variant
                      RYPLcFGWCf Nef(134-143) observed variant
                      RfPLcFGWCf Nef(134-143) observed variant
                      R(f)YPLcFGWCf Nef(134-143) observed variant
                      RYPLcF(a)GWCf Nef(134-143) observed variant
                      RYPLTFGWCF Nef(134-143) A*24 human epitope
                      RfPLTFGWCF Nef(134-143) literature escape; observed variant
                      kfPLTFGWCF Nef(134-143) observed variant
                      RYPLTlGWCF Nef(134-143) inferred escape
                      RYPLTFGWCF Nef(134-143) A*24 human epitope
                      RYPLcFGWCF Nef(134-143) subtype-specific susceptible form
                      RYPLTFGWCF Nef(134-143) A*24 human epitope
                      RYPLTFGWCY Nef(134-143) A24 human epitope
                      RYPLTFGWCY Nef(134-143) A24 human epitope
                      RYPLTFGWCY Nef(134-143) A24 human epitope
                      RYPLTFGWCF Nef(134-143) A24 human epitope
                      RYPLTFGWCY Nef(134-143) A24, B35 human epitope
                      RYPLTFGWCf Nef(134-143) observed variant
                      RfPLTFGWCf Nef(134-143) observed variant
                      RYPLTyGWCf Nef(134-143) observed variant
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RYPLcFGWCF Nef(134-143) subtype-specific susceptible form
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RfPLTFGWCF Nef(134-143) diminished HLA binding or increased off-rate
                      RYPLTlGWCF Nef(134-143) observed variant
                      RYPLTFGWCy Nef(134-143) observed variant
                      RfPLTFGWCy Nef(134-143) observed variant
                      RYPLTFGWpF Nef(134-143) observed variant
                      RfPLTFGWpF Nef(134-143) observed variant
                      RxPLTFGWpF Nef(134-143) observed variant
                      RYPiTFGWCF Nef(134-143) observed variant
                      RfPmTFGWCF Nef(134-143) observed variant
                      RYPcTFGWCF Nef(134-143) observed variant
                      RfPcTFGWCF Nef(134-143) observed variant
                      RwPLTFGWCF Nef(134-143) observed variant
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RYPLTFGWCY Nef(134-143) A*2402 human epitope
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RFPLTFGWCF Nef(134-143) literature escape; susceptible form; TCR related mutation
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RfPLTFGWCF Nef(134-143) escape documented in this paper; processing
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RYPLTFGWCY Nef(134-143) A*2402 human epitope
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RfPLTFGWCF Nef(134-143) escape documented in this paper; observed variant
                      RfPLcFGWCF Nef(134-143) escape documented in this paper; observed variant
                      RlPLTFGWCF Nef(134-143) observed variant
                      RwPLTFGWCF Nef(134-143) observed variant
                      RYPLTFGWCy Nef(134-143) observed variant
                      RYPLTlGWCF Nef(134-143) observed variant
                      RYPLTlGWCy Nef(134-143) observed variant
                      RYPLTFGWpF Nef(134-143) observed variant
                      RYPLcFGWCF Nef(134-143) observed variant
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RYPLTFGWCY Nef(134-143) A*2402 human epitope
                      RfPLTFGWCY Nef(134-143) escape documented in this paper
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RfPLTFGWCF Nef(134-143) escape documented in this paper
                      RYPLTFGWCy Nef(134-143) observed variant
                      RYPLcFGWCF Nef(134-143) observed variant
                      RfPLcFGWCF Nef(134-143) observed variant
                      RfPLlFGWCF Nef(134-143) observed variant
                      RfPiTFGWCF Nef(134-143) observed variant
                      RYPLTFGWpF Nef(134-143) observed variant
                      RlPLTFGWCF Nef(134-143) observed variant
                      RfPLTFGWsF Nef(134-143) observed variant
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RfPLTFGWCF Nef(134-143) TCR related mutation
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RfPLTFGWCF Nef(134-143) observed variant
                      RfPiTFGWCF Nef(134-143) observed variant
                      RYPiTFGWCF Nef(134-143) observed variant
                      RYPLTFGWCF Nef(134-143) A*2402 human epitope
                      RfPLTFGWCF Nef(134-143) inferred escape; literature escape; replicative capacity reduced
                      RYPiTFGWCF Nef(134-143) observed variant
                      RfPiTFGWCF Nef(134-143) observed variant
                      RfPLcFGWCF Nef(134-143) observed variant
                      RYPLcFGWCF Nef(134-143) inferred escape; literature escape
                      RYPLCFGWCF Nef(134-143) A*2402 human epitope
                      RYPLtFGWCF Nef(134-143) subtype-specific susceptible form
                      RYPLTFGWCF Nef(134-143) B*35 human epitope
                      RYPLTFGWCY Nef(134-143) Cw*07 human epitope
                      RYPLTFGWCY Nef(134-143) Cw*0702 human epitope
                      RYPLTFGWCf Nef(134-143) HLA binding unchanged
                      RYPLTFGWC- Nef(134-143) diminished HLA binding or increased off-rate
                      RfPLTFGWCY Nef(134-143) diminished HLA binding or increased off-rate
                      RlPLTFGWCY Nef(134-143) diminished HLA binding or increased off-rate
                      --PLTFGWCFKL Nef(134-143) diminished HLA binding or increased off-rate
                      RYPLTFGWCF Nef(134-143) human epitope
                      --PLTFGWCyKL Nef(134-143) HLA association; susceptible form
                      -fPLTFGWCG Nef(134-143) HLA association; susceptible form
                      -YPLTFGWCy Nef(134-143) HLA association; susceptible form
                      {t}RYPLTFGW Nef(134-143) HLA association; susceptible form
                      RYPLTFGWCFY Nef(134-144) A11 human epitope
                      RYPLTFGWCYK Nef(134-144) B18 human epitope
                      RYPLcFGWCYK Nef(134-144) escape documented in this paper
                      RYPLTFGWCYK Nef(134-144) B18 human epitope
                      RYPLTFGWCFKLVPV Nef(134-148) human epitope
                      RYPLTFGWCFKLVPV Nef(134-148) human epitope
                       YPLTFGWCF Nef(135-143) A2 human epitope
                       YPLTFGWCY Nef(135-143) A*23 human epitope
                       YPLTFGWCF Nef(135-143) A*23 human epitope
                       YPLTFGWCF Nef(135-143) A*24 human epitope
                       FPLTFGWCF Nef(135-143) A*2402 human epitope
                       YPLTFGWCY Nef(135-143) B*07, B*35 human epitope
                       YPLTFGWCY Nef(135-143) B*0702 human epitope
                       YPLTFGWCY Nef(135-143) B*0702 human epitope
                       YPLTFGWCF Nef(135-143) B*0702, B*1801 human epitope
                       YPLTFGWCF Nef(135-143) B*18 human epitope
                       YPLTFGWCY Nef(135-143) B*18 human epitope
                       YPLTFGWCF Nef(135-143) B*18 human epitope
                       YPLTFGWCF Nef(135-143) B*18 human epitope
                       YPLTFGWCF Nef(135-143) B*18, B*35 human epitope
                       YPLTFGWCY Nef(135-143) B18 human epitope
                       YPLTFGWCY Nef(135-143) B18 human epitope
                       YPLTFGWCY Nef(135-143) B18 human epitope
                       YPLTFGWCY Nef(135-143) B18 human epitope
                       YPLTFGWCY Nef(135-143) B18 human epitope
                       YPLTFGWCF Nef(135-143) B18 human epitope
                       YPLTFGWCY Nef(135-143) B18 human epitope
                       YPLTFGWCF Nef(135-143) B18 human epitope
                       YPLTFGWCY Nef(135-143) B18 human epitope
                       YPLTFGWCF Nef(135-143) B18, B35 human epitope
                       fPLTFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                       YPLcFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                       fPLcFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                       YPLTFGWCy Nef(135-143) susceptible form; subtype-specific susceptible form
                       YPLTlGWCF Nef(135-143) non-susceptible form; susceptible form; subtype-specific non-susceptible form
                       YPLTFGWCY Nef(135-143) B18, B35, B49, B53, B7 human epitope
                       YPLTFGWCf Nef(135-143) susceptible form
                       YPLTFGWCF Nef(135-143) B*5301, B18, B35 human epitope
                       YPLTFGWCY Nef(135-143) B18, B49 human epitope
                       YPLTFGWCf Nef(135-143) susceptible form
                       YPLTFGWCY Nef(135-143) B18, B53, B7 human epitope
                       YPLTFGWCf Nef(135-143) observed variant
                       fPLTFGWCf Nef(135-143) observed variant
                       YPLTyGWCf Nef(135-143) observed variant
                       YPLTFGWCF Nef(135-143) B*5301, B18 human epitope
                       YPLTFGWCY Nef(135-143) B*1801 human epitope
                       YPLTFGWCF Nef(135-143) B*1801 human epitope
                       YPLTGWCF Nef(135-143) B*1801 human epitope
                       YPLTFGWCF Nef(135-143) B*1801 human epitope
                       YPLTFGWCF Nef(135-143) B*35 human epitope
                       YPLTFGWCF Nef(135-143) B*35 human epitope
                       YPLTFGWCF Nef(135-143) B*35 human epitope
                       YPLTFGWCF Nef(135-143) B*35 human epitope
                       YPLcFGWCF Nef(135-143) subtype-specific susceptible form
                       YPLTFGWCY Nef(135-143) B*35, B*5301 human epitope
                       YPLTFGWCY Nef(135-143) B35 human epitope
                       YPLTFGWCF Nef(135-143) B35 human epitope
                       YPLTFGWCY Nef(135-143) B35 human epitope
                       YPLTFGWCY Nef(135-143) B35 human epitope
                       YPLTFGWCY Nef(135-143) B35 human epitope
                       YPLTFGWCF Nef(135-143) B35 human epitope
                       YPLTFGWCF Nef(135-143) B*3501 human epitope
                       fPLTFGWCF Nef(135-143) observed variant; replicative capacity reduced
                       lPLTFGWCF Nef(135-143) observed variant; replicative capacity is not abrogated; susceptible form
                       YPLTFGWCY Nef(135-143) B*3501 human epitope
                       YPLTFGWCF Nef(135-143) B*3501 human epitope
                       YPLTFGWCY Nef(135-143) B*3501, B*3508 human epitope
                       YPLTFGWCF Nef(135-143) B*3501, B*5301 human epitope
                       YPLTFGWCY Nef(135-143) B*3502, B*3503, B*5301 human epitope
                       YPLTFGWCF Nef(135-143) B*3502, B*3503, B*5301 human epitope
                       YPLTFGWCY Nef(135-143) B49 human epitope
                       YPLTFGWCY Nef(135-143) B49 human epitope
                       YPLTFGWCf Nef(135-143) observed variant
                       YLPTFGWCY Nef(135-143) B49 human epitope
                       YLPTFGWCf Nef(135-143) observed variant
                       YPLTFGWCY Nef(135-143) B49 human epitope
                       YPLTFGWCF Nef(135-143) B*53 human epitope
                       YPLTFGWCF Nef(135-143) B*53 human epitope
                       YPLTFGWCY Nef(135-143) B53 human epitope
                       YPLTFGWCF Nef(135-143) B53 human epitope
                       YPLTFGWCF Nef(135-143) B*5301 human epitope
                       YPLTFGWCY Nef(135-143) B*5301 human epitope
                       YPLTFGWCY Nef(135-143) B*5301 human epitope
                       YPLTFGWCF Nef(135-143) B*5301 human epitope
                       YPLTFGWCF Nef(135-143) B*57 human epitope
                       YPLTFGWCF Nef(135-143) B*5801 human epitope
                       YPLTFGWCF Nef(135-143) B7 human epitope
                       YPLTFGWCY Nef(135-143) B7 human epitope
                       YPLTFGWCY Nef(135-143) B7 supertype human epitope
                       YPLTFGWCF Nef(135-143) C*02 human epitope
                       YPLTFGWCF Nef(135-143) C*04 human epitope
                       YPLTFGWCY Nef(135-143) Cw*0702 human epitope
                       YPLTFGWCFKLVPV Nef(135-148) human epitope
                       YPLTFGWCFKLVPV Nef(135-148) human epitope
                        PLTFGWCYK Nef(136-144) A3 human epitope
                        PLTFGWCYKL Nef(136-145) A*02 human epitope
                        PLTFGWCYKL Nef(136-145) A*02 human epitope
                        PLTFGWCYKL Nef(136-145) A*02 human epitope
                        PLcFGWCfKL Nef(136-145) subtype-specific non-susceptible form
                        PLTFGWCYKL Nef(136-145) A*02 human epitope
                        PLTFGWCFKL Nef(136-145) A*02 human epitope
                        PLTFGWCYKL Nef(136-145) A*02 human epitope
                        PLTFGWCYKL Nef(136-145) A*02 human epitope
                        PLcFGWCfKL Nef(136-145) observed variant
                        PLcF(a)GWCfKL Nef(136-145) observed variant
                        PLTFGWCYKL Nef(136-145) A*0201 human epitope
                        PLTFGWCYKL Nef(136-145) A*0201 human epitope
                        PLTFGWCFKL Nef(136-145) A*0201 transgenic mouse epitope
                        PLTFGWCYKL Nef(136-145) A*0201 human epitope
                        PLTFGWCYKL Nef(136-145) A*0201 human epitope
                        PLTFGWCYKL Nef(136-145) A2 human epitope
                        PLTFGWCYKL Nef(136-145) A2 human epitope
                        PLTFGWCFKL Nef(136-145) A2 human epitope
                        PLTFGWCYKL Nef(136-145) A2 human epitope
                        PLTFGWCYKL Nef(136-145) A2 human epitope
                        PLTFGWCYKL Nef(136-145) A*32 human epitope
                        PLTFGWCYKL Nef(136-145) B*07 human epitope
                        PLTFGWCYKL Nef(136-145) B*18 human epitope
                        PLTFGWCYKL Nef(136-145) B*3502, B*3503, B*5301 human epitope
                        PLTFGWCYKL Nef(136-145) B*49 human epitope
                        PLTFGWCYKL Nef(136-145) B*5801 human epitope
                        PLTFGWCYKL Nef(136-145) C*14 human epitope
                        PLTFGWCFKL Nef(136-145) human epitope
                        PLTFGWCyKL Nef(136-145) observed variant
                        PLTFGWCFKL Nef(136-145) human epitope
                        PLTLGWCFKL Nef(136-145) observed variant
                        PITFGWCFKL Nef(136-145) susceptible form
                        PVTFGWCFKL Nef(136-145) susceptible form
                        PLCFGWCFKL Nef(136-145) susceptible form
                        PVCFGWCFKL Nef(136-145) observed variant
                        PMCFGWCFKL Nef(136-145) susceptible form
                        PLCFGWCFKP Nef(136-145) susceptible form
                        PLTFGWCFKL Nef(136-145) human epitope
                        PLTFGWCYKLV Nef(136-146) A*0201 human epitope
                         LTFGWCFKL Nef(137-145) A*02 human epitope
                         LTFGWCFKL Nef(137-145) A*0201 human epitope
                         LTFGWCFKL Nef(137-145) A*0201 human epitope
                         LTFGWCFKL Nef(137-145) A*0201 human epitope
                         LTFGWCFKL Nef(137-145) A*0201 mouse epitope
                         LTFGWCFKL Nef(137-145) A2 human epitope
                         LTFGWCYKL Nef(137-145) A2 human epitope
                         LTFGWCFKL Nef(137-145) A2 human epitope
                         LTFGWCFKL Nef(137-145) A2 human epitope
                         LTFGWCFKL Nef(137-145) A2 human epitope
                         LTFGWCFKL Nef(137-145) A*23 human epitope
                         LTFGWCFKL Nef(137-145) A*25 human epitope
                         LTFGWCFKL Nef(137-145) A2 supertype human epitope
                         LTFGWCFKL Nef(137-145) A2 supertype human, mouse epitope
                         LTFGWCFKL Nef(137-145) A*32 human epitope
                         LTFGWCFKL Nef(137-145) A*6802 human epitope
                         LTFGWCFKL Nef(137-145) A*80 human epitope
                         LTFGWCFKL Nef(137-145) B*1517, B57 human epitope
                         LTFGWCFKL Nef(137-145) B*1540 human epitope
                         LTFGWCFKL Nef(137-145) B*57 human epitope
                         LTFGWCFKL Nef(137-145) B*57 human epitope
                         LTFGWCFKL Nef(137-145) B*63 human epitope
                         LTFGWCFKL Nef(137-145) C*14 human epitope
                         LTFGWCFKL Nef(137-145) human epitope
                         LTFGWCFKL Nef(137-145) human epitope
                         LTFGWCFKL Nef(137-145) human epitope
                         LTFGWCFKLV Nef(137-146) A2 human epitope
                         LTFGWCFKLV Nef(137-146) A2 human epitope
                         LTFGWCFKLV Nef(137-146) A2 human epitope
                         LTFGWCFKLV Nef(137-146) A2 human epitope
                         LTFGWCFKLV Nef(137-146) A2 human epitope
                         LTFGWCFKLV Nef(137-146) A2 human epitope
                         LTFGWCFKLV Nef(137-146) A*23 human epitope
                         LTFGWCFKLV Nef(137-146) A2 supertype human epitope
                         LTFGWCFKLV Nef(137-146) A*32 human epitope
                         LTFGWCFKLV Nef(137-146) A*6802 human epitope
                         LTFGWCFKLV Nef(137-146) A*80 human epitope
                         LTFGWCFKLV Nef(137-146) B*1517 human epitope
                         RRHRILDIYL Nef(137-146) Mamu B*08 macaque epitope
                         LTFGWCYKLV Nef(137-146) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Operated by Los Alamos National Security, LLC, for the U.S. Department of Energy's National Nuclear Security Administration
Copyright © 2006-2017 LANS LLC All rights reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health