HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

DLWVYHTQGYFPDWQNYTPG Nef(111-130) human epitope
 LWIYHTQGYFPDWQNYTPGPGV Nef(112-133) human epitope
 LWIYHTQGYFPDWQNYTPGPGV Nef(112-133) human epitope
 LWIYHTQGYFPDWQNYTPGPGV Nef(112-133) human epitope
  WIYHTQGYFPDWQNYT Nef(113-128) A*01 human epitope
  WIYHTQGYFPDWQNYT Nef(113-128) A1 human epitope
  WVHHTQGYFPDWQNYT Nef(113-128) human epitope
    YHTQGYFPDWQNYTP Nef(115-129) human epitope
     HTQGYFPDWQNYTPG Nef(116-130) human epitope
     HTQGYFPDWQNYTPG Nef(116-130) human epitope
     HTQGYFPDWQNYTPG Nef(116-130) human epitope
      TQGYFPDWQNYT Nef(117-128) B17, B37 human epitope
      TQGYFPDWQNYT Nef(117-128) human epitope
      TQGYFPDWQNYTPGP Nef(117-131) B57 human epitope
      TQGYFPDWQNYTPGP Nef(117-131) human epitope
      TQGYFPDWQNYTPGP Nef(117-131) human epitope
      TQGYFPDWQNYTPGPGVRYPLTFGWCYKLVP Nef(117-147) human epitope
       QGYFPDWQNYTPGPGVRY Nef(118-135) C*16 human epitope
       QGYFPDWQNYTPGPGIRY Nef(118-135) human epitope
       QGYFPDWQNYTPGPGRF Nef(118-135) human epitope
       QGYFPDWQNYTPGPvRy Nef(118-135) subtype-specific susceptible form
       QGYFPDWQNYTPGPGIRY Nef(118-135) human epitope
         YFPDWQNYT Nef(120-128) A*01 human epitope
         YFPDWQNYT Nef(120-128) A1 human epitope
         YFPDWQNYT Nef(120-128) A1 human epitope
         YFPDWQNYT Nef(120-128) A1 human epitope
         YFPDWQNYT Nef(120-128) A1 human epitope
         YFPDWQNYT Nef(120-128) A1 human epitope
         YFPDWQNYT Nef(120-128) A1 human epitope
         YFPDWQNYT Nef(120-128) A1 human epitope
         YFPDWQNYT Nef(120-128) A1, A29 human epitope
         YFPDWQNYT Nef(120-128) A1, B*37:01, B*57:01 human epitope
         YFPDWQNYT Nef(120-128) A*29 human epitope
         YFPDWQNYT Nef(120-128) A*29 human epitope
         YFPDWQNYT Nef(120-128) A29 human epitope
         YFPDWQNYT Nef(120-128) A29, B*35:01, Cw6 human epitope
         FFPDWKNYT Nef(120-128) B15 human epitope
         lFPDWKNYT Nef(120-128) escape documented in this paper
         YFPDWQNYT Nef(120-128) B*18 human epitope
         YFPDWQNYT Nef(120-128) B*37 human epitope
         YFPDWQNYT Nef(120-128) B37, B57 human epitope
         YFPDWQNYT Nef(120-128) B37, B57 human epitope
         YFPDWQNYT Nef(120-128) B*49 human epitope
         YFPDWQNYT Nef(120-128) B*51 human epitope
         FFPDWKNYT Nef(120-128) B51 human epitope
         yFPDWqNYT Nef(120-128) escape documented in this paper
         yFPDWhNYT Nef(120-128) escape documented in this paper
         yFPDWqsYT Nef(120-128) escape documented in this paper
         ylPDWqsYT Nef(120-128) escape documented in this paper
         yFPDWdNYT Nef(120-128) escape documented in this paper
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B*57 human epitope
         YFPDWQNYT Nef(120-128) B57 human epitope
         YFPDWQDYT Nef(120-128) B57 human epitope
         YFPDWQNYT Nef(120-128) B57 human epitope
         YFPDWQNYT Nef(120-128) B*58:01, B57 human epitope
         YFPDWQNYT Nef(120-128) B57, B63 human epitope
         YFPDWQNYT Nef(120-128) B*57:01 human epitope
         YFPDWQcYT Nef(120-128) observed variant
         YFPDWQchT Nef(120-128) observed variant
         YFPDWQNYT Nef(120-128) B58 human epitope
         YFPDWQNYT Nef(120-128) C*01 human epitope
         YFPDWQNYT Nef(120-128) C*06 human epitope
         YFPDWQNYT Nef(120-128) C*06 human epitope
         YFPDWQNYT Nef(120-128) C*14 human epitope
         YFPDWQNYT Nef(120-128) human epitope
         YFPDWQNYT Nef(120-128) human epitope
         YFPDWQDYT Nef(120-128) human epitope
         YFPDWQNYT Nef(120-128) human epitope
         YFPDWQNYT Nef(120-128) human epitope
         YFPDWQNYTP Nef(120-129) B*57 human epitope
         YFPDWQNYTPGPGIR Nef(120-134) human epitope
         YFPDWQNYTPGPGIRYPLTFGWCYK Nef(120-144) A24 human epitope
          FPDWQNYT Nef(121-128) A*01 human epitope
          FPDWhNYT Nef(121-128) observed variant
          FPDWQyYT Nef(121-128) observed variant
          FPeWgNYT Nef(121-128) observed variant
          FPDWQNYT Nef(121-128) A*01 human epitope
          FPDWQNYT Nef(121-128) A1 human epitope
          FPDWQNYTP Nef(121-129) B*54:01 human epitope
          FPDWQNYTP Nef(121-129) B*54:01 human epitope
          FPDWQNYTP Nef(121-129) human epitope
          FPDWQNYTPGPGIRY Nef(121-135) A*02:01 human epitope
          FPDWQNYTPGPGIRY Nef(121-135) A24 human epitope
          FPDWQNYTPGPGIRY Nef(121-135) human epitope
          FPDWQNYTPGPGIRYPLT Nef(121-138) human epitope
          FPDWQNYTPGPGIRYPLT Nef(121-138) human epitope
          FPDWQNYTPGPGtRYPLT Nef(121-138) observed variant
           PDWQNYTPGPGVRYP Nef(122-136) human epitope
           PDWQNYTPGPGVRYPLTFGW Nef(122-141) B*35 human epitope
           PDWQNYTPGPGVRYPLTFGW Nef(122-141) human epitope
            QWQNYTPGPGVRYPL Nef(123-137) human epitope
             WQNYTPGPGIRYPLT Nef(124-138) human epitope
             WQNYTPGPGIRYPLT Nef(124-138) human epitope
              QNYTPGPGIRYPLTF Nef(125-139) A*02:01 human epitope
              QNYTPGPGVRYPLTF Nef(125-139) human epitope
              QNYTPGPGRFPLTFGWCF Nef(125-143) human epitope
              QNYTPGPGvRyPLTFGWCF Nef(125-143) subtype-specific susceptible form
               NYTPGPGVRY Nef(126-135) A24 human epitope
               NYTPGPGIRY Nef(126-135) A*24:02 human epitope
               NYTPGPGvRY Nef(126-135) observed variant
               cYTPGPGtRY Nef(126-135) observed variant
               NYTPGPGtRY Nef(126-135) observed variant
               NYTPGPGIRf Nef(126-135) observed variant
               NYTPGPGtRf Nef(126-135) observed variant
               cYTPGPGIRf Nef(126-135) observed variant
               gYTPGPGIRf Nef(126-135) observed variant
               cYTPGPGtRf Nef(126-135) observed variant
               gYTPGPGtRf Nef(126-135) observed variant
               NYTPGPGvRf Nef(126-135) observed variant
               NYTPGPGeRf Nef(126-135) observed variant
               NYTPGPGvRl Nef(126-135) observed variant
               NYTPGPGtRw Nef(126-135) observed variant
               NYTPGPGIRY Nef(126-135) A*24:02 human epitope
               NYTPGPGVRYPLT Nef(126-138) B7 human epitope
               NYTPGPGTRYPLTFG Nef(126-140) A24 human epitope
               NYTPGPGTRYPLTFG Nef(126-140) B35 human epitope
               NYTPGPGTRYPLTFG Nef(126-140) human epitope
               NYTPGPGVRYPLTFGWCF Nef(126-143) C*14 human epitope
               NYTPGPGIRYPLTFGWCF Nef(126-143) human epitope
               NYTPGPGIRYPLTFGWCF Nef(126-143) human epitope
               NYTPGPGIRYPLCFGWCF Nef(126-143) human epitope
                YTPGPGIRY Nef(127-135) A*23 human epitope
                YTPGPGIRY Nef(127-135) A*24 human epitope
                YTPGPGIRY Nef(127-135) B*35:02, B*35:03, B*53:01 human epitope
                YTPGPGIRY Nef(127-135) B*57 human epitope
                YTPGPGIRY Nef(127-135) B*57 human epitope
                YTPGPGIRY Nef(127-135) B57, B58 human epitope
                YTPGPGVRY Nef(127-135) B*58:01 human epitope
                YTPGPGIRY Nef(127-135) B*63 human epitope
                YTPGPGVRY Nef(127-135) human epitope
                YTPGPGTRY Nef(127-135) human epitope
                YTPGPGIRY Nef(127-135) human epitope
                YTPGPGVRYPLTFGW Nef(127-141) A24 human epitope
                YTPGPGVRYPLTFGW Nef(127-141) B35 human epitope
                YTPGPGVRYPLTFGW Nef(127-141) human epitope
                 TPGPGVRY Nef(128-135) B*07:02 human epitope
                 TPGPGVRY Nef(128-135) B7 supertype human epitope
                 TPGPGVRYP Nef(128-136) B*07 human epitope
                 TPGPGVRYPL Nef(128-137) B*07 human epitope
                 TPGPGVRYPL Nef(128-137) B*07 human epitope
                 TPGPGVRYPL Nef(128-137) B*07 human epitope
                 TPGPGVRYPL Nef(128-137) B*07 human epitope
                 TPGPGVRYPL Nef(128-137) B*07 human epitope
                 TPGPGVKYPL Nef(128-137) B*07 human, transgenic mouse epitope
                 TPGPGiKYPL Nef(128-137) susceptible form
                 TPGPGVRYPL Nef(128-137) B*07 human epitope
                 TPGPGVRYPL Nef(128-137) B*07 human epitope
                 TPGPGVRYPL Nef(128-137) B*07, B*42 human epitope
                 TPGPGVRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGTRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGiRYPL Nef(128-137) non-susceptible form
                 TPGPGvRYPL Nef(128-137) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                 TPGPGTRfPL Nef(128-137) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                 TPGPGIRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGvRYPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                 TPGPGvRfPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                 TPGPGvRwPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                 TPGPGvRlPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                 TPGPGtRfPL Nef(128-137) diminished response; escape documented in this paper; susceptible form
                 TPGPGIRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGvRYPL Nef(128-137) subtype-specific susceptible form
                 TPGPGVRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGVRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGVRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGIRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGvRYPL Nef(128-137) susceptible form
                 TPGPGVRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGVRYPL Nef(128-137) B*07:02 human epitope
                 TPGPGVRYPL Nef(128-137) B*07:02, B*42:01 human epitope
                 TPGPGVRYPL Nef(128-137) B*07:02, B7 human epitope
                 TPGPGVRYPL Nef(128-137) B35 human epitope
                 TPGPGVRYPL Nef(128-137) B35 human epitope
                 TPGPGTRYPL Nef(128-137) B35 human epitope
                 TPGPGvRYPL Nef(128-137) susceptible form
                 TPGPGVRYPL Nef(128-137) B*35:01 human epitope
                 TsGPGVRYPL Nef(128-137) susceptible form
                 TPGPGVRYPL Nef(128-137) B*35:02, B*35:03, B*53:01 human epitope
                 TPGPGVRYPL Nef(128-137) B*42 human epitope
                 TPGPGIRYPL Nef(128-137) B42 human epitope
                 TPGPGVRYPL Nef(128-137) B*42:01 human epitope
                 TsGPGVRYPL Nef(128-137) diminished HLA binding or increased off-rate; escape documented in this paper
                 TqGPGVRYPL Nef(128-137) diminished HLA binding or increased off-rate; escape documented in this paper
                 TPGPGVRYPL Nef(128-137) B*42:01 human epitope
                 TPGPGVRYPL Nef(128-137) B*42:01 human epitope
                 TPGPGVRYPL Nef(128-137) B*42:01 human epitope
                 TPGPGVRYPL Nef(128-137) B*42:01 human epitope
                 TPGPGVRYPL Nef(128-137) B*42:01 human epitope
                 TPGPGVRYPL Nef(128-137) B*42:01, B*42:02 human epitope
                 TPGPGVRYPL Nef(128-137) B*42:02 epitope
                 TPGPGIRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGiRYPL Nef(128-137) susceptible form
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human, macaque epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGiRYPL Nef(128-137) observed variant
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGiRYPL Nef(128-137) observed variant
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 human epitope
                 TPGPGVRYPL Nef(128-137) B*81:01, B7 human epitope
                 TPGPGVRYPL Nef(128-137) B*81:01, B7 human epitope
                 TPGPGVRYPL Nef(128-137) B7 supertype human epitope
                 TPGPGVRYPL Nef(128-137) B*81:01 human epitope
                 TPGPGVRYPL Nef(128-137) C*17 human epitope
                 TPGPGVRYPL Nef(128-137) human epitope
                 TPGPGTRYPL Nef(128-137) human epitope
                 TPGPGIRFPL Nef(128-137) susceptible form
                 TPGPGIRYPL Nef(128-137) susceptible form
                 TPGPGIRYPV Nef(128-137) susceptible form
                 TPGPGIRFPI Nef(128-137) susceptible form
                 TSGPGTRFPL Nef(128-137) susceptible form
                 IPGPG-RHPL Nef(128-137) observed variant
                 TPGPGVRYPL Nef(128-137) observed variant
                 TPGPGPRYPL Nef(128-137) susceptible form
                 TPGPGTRFPL Nef(128-137) observed variant
                 TPGPGPRFPL Nef(128-137) observed variant
                 TPGPGIRYPM Nef(128-137) susceptible form
                 TPGPGPRYPV Nef(128-137) susceptible form
                 TPGPGPRYPM Nef(128-137) susceptible form
                 TKGPGIRFPL Nef(128-137) susceptible form
                 TPGPGPRYPM Nef(128-137) susceptible form
                 TPGPGIRYPL Nef(128-137) human epitope
                 TPGPGvRYPL Nef(128-137) HLA association; susceptible form
                 TPGPGRFPL Nef(128-137) human epitope
                 TPGPGvryPL Nef(128-137) observed variant
                 TPGPGVRYPL Nef(128-137) human epitope
                 TPGPGIRYPL Nef(128-137) human epitope
                 TPGPGIRYPLTFGW Nef(128-141) human epitope
                 TPGPGIRYPLTFGW Nef(128-141) human epitope
                 TPGPGIRYPLTFGW Nef(128-141) human epitope
                  PGPGTRFPLTFGWCF Nef(129-143) A23 human epitope
                  PGPGTRFPLTFGWCF Nef(129-143) A24 human epitope
                  PGPGIRYPLCFGWCF Nef(129-143) B35 human epitope
                  PGPGTRFPLTFGWCF Nef(129-143) B35 human epitope
                  PGPGIRYPLTFGWCF Nef(129-143) B57 human epitope
                  PGPGIRYPLTFGWCF Nef(129-143) human epitope
                  PGPGtRfPLTFGWCF Nef(129-143) observed variant
                  PGPGIRYPLTFGWCF Nef(129-143) human epitope
                  PGPGpRYPLTFGWCF Nef(129-143) non-susceptible form; susceptible form
                  {PGPGT}RYPLTFGW{CFKLV} Nef(129-146) A*24 human epitope
                  {PGPGT}RYPLTlGW{CFKLV} Nef(129-146) non-susceptible form; observed variant
                  {PGPGT}RYPLmFGW{CFKLV} Nef(129-146) observed variant; susceptible form
                  {PGPGi}RfPLTFGW{CFKLV} Nef(129-146) observed variant; susceptible form
                  PGPGVRYPLTFGWCFKLV Nef(129-146) human epitope
                  PGPGIRYPLTFGWCFKLV Nef(129-146) human epitope
                  PGPGVRYPLTFGWCFKLVP Nef(129-147) human epitope
                   GPGVRYPLTF Nef(130-139) B35 human epitope
                   GPGVRYPLTF Nef(130-139) B35 human epitope
                   GPGTRFPLTR Nef(130-139) B7 human epitope
                   GPGIRYPLTFGWCF Nef(130-143) B*57 human epitope
                   GPGVRYPLTFGWCY Nef(130-143) B*57 human epitope
                   GPGVRYPLTFGWCY Nef(130-143) B*57 human epitope
                   GPGVRYPLTFGWCY Nef(130-143) B57 human epitope
                   GPGIRYPLTFGWCF Nef(130-143) B*58:01, B57 human epitope
                   GPGVRYPLTFGWCYK Nef(130-144) human epitope
                   GPGTRFPLTFGWCFKLV Nef(130-146) human epitope
                    PGIRYPLTFGWCFKL Nef(131-145) A23 human epitope
                    PGIRYPLTFGWCFKL Nef(131-145) A24 human epitope
                    PGIRYPLTFGWCFKL Nef(131-145) B35 human epitope
                    PGIRYPLTFGWCFKL Nef(131-145) human epitope
                    PGIRYPLTFGWCFKL Nef(131-145) human epitope
                    PGIRYPLTFGWCFKL Nef(131-145) human epitope
                    PGIRYPLTFGWCFKL Nef(131-145) human epitope
                    PGIRYPLTFGWCFKLVPVEP Nef(131-150) human epitope
                     GIRYPLTFGWCFK Nef(132-144) human epitope
                     GvRYPLTFGWCFK Nef(132-144) observed variant
                     GIRYPLcFGWCFK Nef(132-144) observed variant
                     GVRYPLTLGWCFKLV Nef(132-146) A24 human epitope
                     GVRYPLTFGWCYKLVP Nef(132-147) A1, B8 human epitope
                     GVRYPLTFGWCYKLVP Nef(132-147) B18 human epitope
                     GVRYPLTFGWCYKLVP Nef(132-147) H-2d mouse epitope
                     GIRYPLTFGWCFKLVP Nef(132-147) human epitope
                     GVRYPLTFGWCYKLVPVEPD Nef(132-151) human epitope
                      TRYPLTFGW Nef(133-141) A*03 human epitope
                      TRYPLTFGW Nef(133-141) A*23 human epitope
                      TRYPLTFGW Nef(133-141) A*24 human epitope
                      TRYPLTFGW Nef(133-141) A*29 human epitope
                      TRYPLTFGW Nef(133-141) A*33 human epitope
                      TRYPLTFGW Nef(133-141) A33 human epitope
                      TRYPLTFGW Nef(133-141) A*68:02 human epitope
                      TRYPLTFGW Nef(133-141) B*18 human epitope
                      VRYPLTFGW Nef(133-141) B27 human epitope
                      VRYPLTFGW Nef(133-141) B*27:02 human epitope
                      VRYPLTFGW Nef(133-141) B*27:05 human epitope
                      TRYPLTFGW Nef(133-141) B*35:01, B*35:08 human epitope
                      TRYPLTFGW Nef(133-141) B*35:02, B*35:03, B*53:01 human epitope
                      TRYPLTFGW Nef(133-141) B*42:01 human epitope
                      VRYPLTFGW Nef(133-141) C*04:01 human epitope
                      IRYPKTFGW Nef(133-141) Mamu B*17 macaque epitope
                      IRYPKTFGW Nef(133-141) Mamu B*17 macaque epitope
                      GRFPLTFGW Nef(133-141) human epitope
                      tRyPLTFGW Nef(133-141) observed variant
                      VRYPLTFGW Nef(133-141) human epitope
                      VRYPLTFGW Nef(133-141) human epitope
                      IRYPLTFGWC Nef(133-142) B*27 human epitope
                      TRYPLTFGWCYKLVP Nef(133-147) A24 human epitope
                      TRYPLTFGWCYKLVP Nef(133-147) B35 human epitope
                      IRYPLTFGWCFKLVP Nef(133-147) human epitope
                      pRYPLTFGWCFKLVP Nef(133-147) non-susceptible form; susceptible form
                      VRYPLTFGWCYKLVPV Nef(133-148) B57 human epitope
                       RYPLTFGW Nef(134-141) A*23 human epitope
                       RYPLTFGW Nef(134-141) A23, A24, B35, B53 human epitope
                       RYPLTFGW Nef(134-141) A*23:01 human epitope
                       RYPLTFGW Nef(134-141) A*23:01 human epitope
                       RYPLTFGW Nef(134-141) A*23:01, A24 human epitope
                       RYPLTFGW Nef(134-141) A*23:01, A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24 human epitope
                       RYPLmFGW Nef(134-141) escape documented in this paper; observed variant
                       RYPLTlGW Nef(134-141) escape documented in this paper; observed variant
                       RfPLTFGW Nef(134-141) escape documented in this paper; observed variant
                       RYPLTFGW Nef(134-141) A*24 human epitope
                       RYPLTFGW Nef(134-141) A*24 human epitope
                       RYPLTFGW Nef(134-141) A*24 human epitope
                       RYPLTFGW Nef(134-141) A24 human epitope
                       RYPLTFGW Nef(134-141) A24 human epitope
                       RYPLTFGW Nef(134-141) A24 human epitope
                       RYPLTFGW Nef(134-141) A24 human epitope
                       RYPLTFGW Nef(134-141) A24 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RfPLTFGW Nef(134-141) susceptible form
                       RYPLTlGW Nef(134-141) non-susceptible form
                       RYPLcFGW Nef(134-141) non-susceptible form
                       RfPLcFGW Nef(134-141) non-susceptible form
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RfPLTFGW Nef(134-141) diminished HLA binding or increased off-rate
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RfPLTFGW Nef(134-141) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                       RYPLcFGW Nef(134-141) diminished response; escape documented in this paper; non-susceptible form; susceptible form
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RfPLTFGW Nef(134-141) TCR related mutation
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RfPLTFGW Nef(134-141) observed variant
                       RfPiTFGW Nef(134-141) observed variant
                       RYPiTFGW Nef(134-141) observed variant
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RfPLTFGW Nef(134-141) altered KIR binding or increased/decreased off-rate
                       RYPLTFGa Nef(134-141) susceptible form
                       RYPLTFGW Nef(134-141) A*24:02 human epitope
                       RYPLTFGW Nef(134-141) A*29 human epitope
                       RYPLTFGW Nef(134-141) A33 human epitope
                       RYPLTFGW Nef(134-141) B*18 human epitope
                       RYPLTFGW Nef(134-141) B*27 human epitope
                       RYPLTFGW Nef(134-141) B27 human epitope
                       RYPLTFGW Nef(134-141) B27 human epitope
                       RYPLTFGW Nef(134-141) B*35:02, B*35:03, B*53:01 human epitope
                       RYPLTFGW Nef(134-141) C*04 human epitope
                       RFPLTFGW Nef(134-141) human epitope
                       RyPLTFGW Nef(134-141) observed variant
                       RYPLTFGWCF Nef(134-143) A*23:01 human epitope
                       RYPLTFGWCF Nef(134-143) A*23:01 human epitope
                       RYPLTFGWCF Nef(134-143) A*23:01, A*24 human epitope
                       RfPLTFGWCF Nef(134-143) altered HLA expression; observed variant
                       RYPLTFGWCF Nef(134-143) A*24 human epitope
                       RYPLcFGWCF Nef(134-143) subtype-specific susceptible form
                       RYPLTFGWCF Nef(134-143) A*24 human epitope
                       RfPLTFGWCF Nef(134-143) literature escape; observed variant
                       kfPLTFGWCF Nef(134-143) observed variant
                       RYPLTlGWCF Nef(134-143) inferred escape
                       RYPLTFGWCF Nef(134-143) A*24 human epitope
                       RYPLTFGWCF Nef(134-143) A*24 human epitope
                       RYPLTFGWCy Nef(134-143) observed variant
                       RYPLTFGWCY Nef(134-143) A*24 human epitope
                       RYPLTFGWCf Nef(134-143) observed variant
                       RYPLTFGWCY Nef(134-143) A*24 human epitope
                       RYPLcFGWCY Nef(134-143) observed variant
                       RYPLcFGWCf Nef(134-143) observed variant
                       RfPLcFGWCf Nef(134-143) observed variant
                       R(f)YPLcFGWCf Nef(134-143) observed variant
                       RYPLcF(a)GWCf Nef(134-143) observed variant
                       RYPLTFGWCF Nef(134-143) A24 human epitope
                       RYPLTFGWCY Nef(134-143) A24 human epitope
                       RYPLTFGWCY Nef(134-143) A24 human epitope
                       RYPLTFGWCY Nef(134-143) A24 human epitope
                       RYPLTFGWCY Nef(134-143) A24, B35 human epitope
                       RYPLTFGWCf Nef(134-143) observed variant
                       RfPLTFGWCf Nef(134-143) observed variant
                       RYPLTyGWCf Nef(134-143) observed variant
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCF Nef(134-143) escape documented in this paper
                       RYPLTFGWCy Nef(134-143) observed variant
                       RYPLcFGWCF Nef(134-143) observed variant
                       RfPLcFGWCF Nef(134-143) observed variant
                       RfPLlFGWCF Nef(134-143) observed variant
                       RfPiTFGWCF Nef(134-143) observed variant
                       RYPLTFGWpF Nef(134-143) observed variant
                       RlPLTFGWCF Nef(134-143) observed variant
                       RfPLTFGWsF Nef(134-143) observed variant
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCF Nef(134-143) inferred escape; literature escape; replicative capacity reduced
                       RYPiTFGWCF Nef(134-143) observed variant
                       RfPiTFGWCF Nef(134-143) observed variant
                       RfPLcFGWCF Nef(134-143) observed variant
                       RYPLcFGWCF Nef(134-143) inferred escape; literature escape
                       RYPLTFGWCY Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCY Nef(134-143) escape documented in this paper
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCF Nef(134-143) escape documented in this paper; processing
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLcFGWCF Nef(134-143) subtype-specific susceptible form
                       RYPLCFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLtFGWCF Nef(134-143) subtype-specific susceptible form
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RFPLTFGWCF Nef(134-143) literature escape; susceptible form; TCR related mutation
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCF Nef(134-143) escape documented in this paper; observed variant
                       RfPLcFGWCF Nef(134-143) escape documented in this paper; observed variant
                       RlPLTFGWCF Nef(134-143) observed variant
                       RwPLTFGWCF Nef(134-143) observed variant
                       RYPLTFGWCy Nef(134-143) observed variant
                       RYPLTlGWCF Nef(134-143) observed variant
                       RYPLTlGWCy Nef(134-143) observed variant
                       RYPLTFGWpF Nef(134-143) observed variant
                       RYPLcFGWCF Nef(134-143) observed variant
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCF Nef(134-143) TCR related mutation
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCF Nef(134-143) diminished HLA binding or increased off-rate
                       RYPLTlGWCF Nef(134-143) observed variant
                       RYPLTFGWCy Nef(134-143) observed variant
                       RfPLTFGWCy Nef(134-143) observed variant
                       RYPLTFGWpF Nef(134-143) observed variant
                       RfPLTFGWpF Nef(134-143) observed variant
                       RxPLTFGWpF Nef(134-143) observed variant
                       RYPiTFGWCF Nef(134-143) observed variant
                       RfPmTFGWCF Nef(134-143) observed variant
                       RYPcTFGWCF Nef(134-143) observed variant
                       RfPcTFGWCF Nef(134-143) observed variant
                       RwPLTFGWCF Nef(134-143) observed variant
                       RYPLTFGWCF Nef(134-143) A*24:02 human epitope
                       RfPLTFGWCF Nef(134-143) observed variant
                       RfPiTFGWCF Nef(134-143) observed variant
                       RYPiTFGWCF Nef(134-143) observed variant
                       RYPLTFGWCY Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCY Nef(134-143) A*24:02 human epitope
                       RYPLTFGWCF Nef(134-143) B*35 human epitope
                       RYPLTFGWCY Nef(134-143) C*07 human epitope
                       RYPLTFGWCY Nef(134-143) C*07:02 human epitope
                       RYPLTFGWCf Nef(134-143) HLA binding unchanged
                       RYPLTFGWC- Nef(134-143) diminished HLA binding or increased off-rate
                       RfPLTFGWCY Nef(134-143) diminished HLA binding or increased off-rate
                       RlPLTFGWCY Nef(134-143) diminished HLA binding or increased off-rate
                       --PLTFGWCf{kl} Nef(134-143) diminished HLA binding or increased off-rate
                       RYPLTFGWCF Nef(134-143) human epitope
                       RYPLTFGWCF Nef(134-143) human epitope
                       --PLTFGWCyKL Nef(134-143) HLA association; susceptible form
                       -fPLTFGWCG Nef(134-143) HLA association; susceptible form
                       -YPLTFGWCy Nef(134-143) HLA association; susceptible form
                       {t}RYPLTFGW Nef(134-143) HLA association; susceptible form
                       RYPLTFGWCF Nef(134-143) human epitope
                       RYPLTFGWCYK Nef(134-144) B18 human epitope
                       RYPLTFGWCYK Nef(134-144) B18 human epitope
                       RYPLcFGWCYK Nef(134-144) escape documented in this paper
                       RYPLTFGWCFKLVPV Nef(134-148) human epitope
                       RYPLTFGWCFKLVPV Nef(134-148) human epitope
                        YPLTFGWCF Nef(135-143) A2 human epitope
                        YPLTFGWCY Nef(135-143) A*23 human epitope
                        YPLTFGWCF Nef(135-143) A*23 human epitope
                        YPLTFGWCF Nef(135-143) A*24 human epitope
                        FPLTFGWCF Nef(135-143) A*24:02 human epitope
                        YPLTFGWCY Nef(135-143) B*07, B*35 human epitope
                        YPLTFGWCY Nef(135-143) B*07:02 human epitope
                        YPLTFGWCY Nef(135-143) B*07:02 human epitope
                        YPLTFGWCF Nef(135-143) B*07:02, B*18:01 human epitope
                        YPLTFGWCF Nef(135-143) B*18 human epitope
                        YPLTFGWCY Nef(135-143) B*18 human epitope
                        YPLTFGWCF Nef(135-143) B*18 human epitope
                        YPLTFGWCF Nef(135-143) B*18 human epitope
                        YPLTFGWCF Nef(135-143) B*18, B*35 human epitope
                        YPLTFGWCY Nef(135-143) B18 human epitope
                        YPLTFGWCY Nef(135-143) B18 human epitope
                        YPLTFGWCF Nef(135-143) B18 human epitope
                        YPLTFGWCY Nef(135-143) B18 human epitope
                        YPLTFGWCY Nef(135-143) B18 human epitope
                        YPLTFGWCF Nef(135-143) B18 human epitope
                        YPLTFGWCY Nef(135-143) B18 human epitope
                        YPLTFGWCY Nef(135-143) B18 human epitope
                        YPLTFGWCY Nef(135-143) B18 human epitope
                        YPLTFGWCF Nef(135-143) B18, B35 human epitope
                        fPLTFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                        YPLcFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                        fPLcFGWCF Nef(135-143) susceptible form; subtype-specific susceptible form
                        YPLTFGWCy Nef(135-143) susceptible form; subtype-specific susceptible form
                        YPLTlGWCF Nef(135-143) non-susceptible form; susceptible form; subtype-specific non-susceptible form
                        YPLTFGWCY Nef(135-143) B18, B35, B49, B53, B7 human epitope
                        YPLTFGWCf Nef(135-143) susceptible form
                        YPLTFGWCF Nef(135-143) B*53:01, B18, B35 human epitope
                        YPLTFGWCY Nef(135-143) B18, B49 human epitope
                        YPLTFGWCf Nef(135-143) susceptible form
                        YPLTFGWCY Nef(135-143) B18, B53, B7 human epitope
                        YPLTFGWCf Nef(135-143) observed variant
                        fPLTFGWCf Nef(135-143) observed variant
                        YPLTyGWCf Nef(135-143) observed variant
                        YPLTFGWCF Nef(135-143) B*53:01, B18 human epitope
                        YPLTGWCF Nef(135-143) B*18:01 human epitope
                        YPLTFGWCF Nef(135-143) B*18:01 human epitope
                        YPLTFGWCF Nef(135-143) B*18:01 human epitope
                        YPLTFGWCY Nef(135-143) B*18:01 human epitope
                        YPLTFGWCY Nef(135-143) B*35 human epitope
                        YPLTFGWCF Nef(135-143) B*35 human epitope
                        YPLTFGWCF Nef(135-143) B*35 human epitope
                        YPLTFGWCF Nef(135-143) B*35 human epitope
                        YPLTFGWCF Nef(135-143) B*35 human epitope
                        YPLcFGWCF Nef(135-143) subtype-specific susceptible form
                        YPLTFGWCY Nef(135-143) B*35 human epitope
                        fPLTFGWCY Nef(135-143) observed variant
                        YPLTlGWCY Nef(135-143) escape documented in this paper
                        YPLcFGWCY Nef(135-143) escape documented in this paper
                        YPLTFGWCY Nef(135-143) B*35, B*53:01 human epitope
                        YPLTFGWCY Nef(135-143) B35 human epitope
                        YPLTFGWCF Nef(135-143) B35 human epitope
                        YPLTFGWCY Nef(135-143) B35 human epitope
                        YPLTFGWCY Nef(135-143) B35 human epitope
                        YPLTFGWCF Nef(135-143) B35 human epitope
                        YPLTFGWCY Nef(135-143) B*35:01 human epitope
                        YPLTFGWCF Nef(135-143) B*35:01 human epitope
                        YPLTFGWCF Nef(135-143) B*35:01 human epitope
                        fPLTFGWCF Nef(135-143) observed variant; replicative capacity reduced
                        lPLTFGWCF Nef(135-143) observed variant; replicative capacity is not abrogated; susceptible form
                        YPLTFGWCY Nef(135-143) B*35:01, B*35:08 human epitope
                        YPLTFGWCF Nef(135-143) B*35:01, B*53:01 human epitope
                        YPLTFGWCF Nef(135-143) B*35:02, B*35:03, B*53:01 human epitope
                        YPLTFGWCY Nef(135-143) B*35:02, B*35:03, B*53:01 human epitope
                        YPLTFGWCY Nef(135-143) B49 human epitope
                        YPLTFGWCY Nef(135-143) B49 human epitope
                        YPLTFGWCY Nef(135-143) B49 human epitope
                        YPLTFGWCf Nef(135-143) observed variant
                        YLPTFGWCY Nef(135-143) B49 human epitope
                        YLPTFGWCf Nef(135-143) observed variant
                        YPLTFGWCF Nef(135-143) B*53 human epitope
                        YPLTFGWCF Nef(135-143) B*53 human epitope
                        YPLTFGWCY Nef(135-143) B53 human epitope
                        YPLTFGWCF Nef(135-143) B53 human epitope
                        YPLTFGWCF Nef(135-143) B*53:01 human epitope
                        YPLTFGWCF Nef(135-143) B*53:01 human epitope
                        YPLTFGWCY Nef(135-143) B*53:01 human epitope
                        YPLTFGWCY Nef(135-143) B*53:01 human epitope
                        YPLTFGWCF Nef(135-143) B*57 human epitope
                        YPLTFGWCF Nef(135-143) B*58:01 human epitope
                        YPLTFGWCY Nef(135-143) B7 human epitope
                        YPLTFGWCF Nef(135-143) B7 human epitope
                        YPLTFGWCY Nef(135-143) B7 supertype human epitope
                        YPLTFGWCF Nef(135-143) C*02 human epitope
                        YPLTFGWCF Nef(135-143) C*04 human epitope
                        YPLTFGWCY Nef(135-143) C*07:02 human epitope
                        YPLTFGWCF Nef(135-143) human epitope
                        YPLTFGWCY Nef(135-143) human epitope
                        YPLTFGWCFKLVPV Nef(135-148) human epitope
                        YPLTFGWCFKLVPV Nef(135-148) human epitope
                         PLTFGWCYK Nef(136-144) A3 human epitope
                         PLTFGWCYKL Nef(136-145) A*02 human epitope
                         PLcFGWCfKL Nef(136-145) observed variant
                         PLcF(a)GWCfKL Nef(136-145) observed variant
                         PLTFGWCYKL Nef(136-145) A*02 human epitope
                         PLTFGWCYKL Nef(136-145) A*02 human epitope
                         PLTFGWCYKL Nef(136-145) A*02 human epitope
                         PLcFGWCfKL Nef(136-145) subtype-specific non-susceptible form
                         PLTFGWCYKL Nef(136-145) A*02 human epitope
                         PLTFGWCYKL Nef(136-145) A*02 human epitope
                         PLTFGWCFKL Nef(136-145) A*02 human epitope
                         PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                         PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                         PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                         PLTFGWCYKL Nef(136-145) A*02:01 human epitope
                         PLTFGWCFKL Nef(136-145) A*02:01 transgenic mouse epitope
                         PLTFGWCFKL Nef(136-145) A2 human epitope
                         PLTFGWCYKL Nef(136-145) A2 human epitope
                         PLTFGWCYKL Nef(136-145) A2 human epitope
                         PLTFGWCYKL Nef(136-145) A2 human epitope
                         PLTFGWCYKL Nef(136-145) A2 human epitope
                         PLTFGWCYKL Nef(136-145) A*32 human epitope
                         PLTFGWCYKL Nef(136-145) B*07 human epitope
                         PLTFGWCYKL Nef(136-145) B*18 human epitope
                         PLTFGWCYKL Nef(136-145) B*35:02, B*35:03, B*53:01 human epitope
                         PLTFGWCYKL Nef(136-145) B*49 human epitope
                         PLTFGWCYKL Nef(136-145) B*58:01 human epitope
                         PLTFGWCYKL Nef(136-145) C*14 human epitope
                         PLTFGWCFKL Nef(136-145) human epitope
                         PLTFGWCyKL Nef(136-145) observed variant
                         PLTFGWCFKL Nef(136-145) human epitope
                         PLTFGWCFKL Nef(136-145) human epitope
                         PLTLGWCFKL Nef(136-145) observed variant
                         PITFGWCFKL Nef(136-145) susceptible form
                         PVTFGWCFKL Nef(136-145) susceptible form
                         PLCFGWCFKL Nef(136-145) susceptible form
                         PVCFGWCFKL Nef(136-145) observed variant
                         PMCFGWCFKL Nef(136-145) susceptible form
                         PLCFGWCFKP Nef(136-145) susceptible form
                         PLTFGWCYKLV Nef(136-146) A*02:01 human epitope
                          LTFGWCFKL Nef(137-145) A*02 human epitope
                          LTFGWCFKL Nef(137-145) A*02:01 human epitope
                          LTFGWCFKL Nef(137-145) A*02:01 human epitope
                          LTFGWCFKL Nef(137-145) A*02:01 mouse epitope
                          LTFGWCFKL Nef(137-145) A*02:01 human epitope
                          LTFGWCFKL Nef(137-145) A2 human epitope
                          LTFGWCFKL Nef(137-145) A2 human epitope
                          LTFGWCYKL Nef(137-145) A2 human epitope
                          LTFGWCFKL Nef(137-145) A2 human epitope
                          LTFGWCFKL Nef(137-145) A2 human epitope
                          LTFGWCFKL Nef(137-145) A*23 human epitope
                          LTFGWCFKL Nef(137-145) A*25 human epitope
                          LTFGWCFKL Nef(137-145) A2 supertype human epitope
                          LTFGWCFKL Nef(137-145) A2 supertype human, mouse epitope
                          LTFGWCFKL Nef(137-145) A*32 human epitope
                          LTFGWCFKL Nef(137-145) A*68:02 human epitope
                          LTFGWCFKL Nef(137-145) A*80 human epitope
                          LTFGWCFKL Nef(137-145) B*15:17, B57 human epitope
                          LTFGWCFKL Nef(137-145) B*15:40 human epitope
                          LTFGWCFKL Nef(137-145) B*57 human epitope
                          LTFGWCFKL Nef(137-145) B*57 human epitope
                          LTFGWCFKL Nef(137-145) B*63 human epitope
                          LTFGWCFKL Nef(137-145) C*14 human epitope
                          LTFGWCFKL Nef(137-145) human epitope
                          LTFGWCFKL Nef(137-145) human epitope
                          LTFGWCFKL Nef(137-145) human epitope
                          LTFGWCFKLV Nef(137-146) A2 human epitope
                          LTFGWCFKLV Nef(137-146) A2 human epitope
                          LTFGWCFKLV Nef(137-146) A2 human epitope
                          LTFGWCFKLV Nef(137-146) A2 human epitope
                          LTFGWCFKLV Nef(137-146) A2 human epitope
                          LTFGWCFKLV Nef(137-146) A2 human epitope
                          LTFGWCFKLV Nef(137-146) A*23 human epitope
                          LTFGWCFKLV Nef(137-146) A2 supertype human epitope
                          LTFGWCFKLV Nef(137-146) A*32 human epitope
                          LTFGWCFKLV Nef(137-146) A*68:02 human epitope
                          LTFGWCFKLV Nef(137-146) A*80 human epitope
                          LTFGWCFKLV Nef(137-146) B*15:17 human epitope
                          LTFGWCYKLV Nef(137-146) human epitope
                          LTFGWCFKLVPVEPEKVE Nef(137-154) human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health