HIV molecular immunology database

 

Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

QARILAVERYLKDQQLLGIWGCSGKLICTTAVPW gp160(577-610) mouse epitope
                LNSWGCAFRQVCHT gp160(593-606) human epitope
                LNmWGCAFRQVCHT gp160(593-606) observed variant
                LNlWGCAFRQVCHT gp160(593-606) observed variant
                LNlWGCAaRQVCHT gp160(593-606) observed variant
                LNmWGCAFRfVCHT gp160(593-606) observed variant
                LNvWGCAFRhVCHT gp160(593-606) observed variant
                LNSWGCAnRQVCHT gp160(593-606) observed variant
                LGIWGCSGKLICTT gp160(593-606) human epitope
                 GIWGCSGKLICTTAV gp160(594-608) B57 human epitope
                 GIWGCSGKLICTTAV gp160(594-608) B57 human epitope
                    GCSGRVICTTTVPWNVSWSNKSLNEI gp160(597-622) B*57:01 human epitope
                    dCSGRVICTTTVPWNVSWSNKSLNEI gp160(597-622) observed variant
                    GCSGRVICTTTVPWNsSWSNKSLNEI gp160(597-622) observed variant
                    GCSGRVICTTTVPWNtSWSNKSLsEI gp160(597-622) observed variant
                    GCSGRVICTTTVPWNtSWSNKSLNEI gp160(597-622) observed variant
                       GKLICTTTVPWNISWSNK gp160(600-617) human epitope
                       GKLICTTTVPWNtSWSNK gp160(600-617) escape documented in this paper
                          ICTTNVPWNSSWSNK gp160(603-617) B*35:01 human epitope
                          ICTTaVPWNaSWSNK gp160(603-617) non-susceptible form
                            TTTVPWNVSW gp160(605-614) B*57:01 human epitope
                            TTTVPWNtSW gp160(605-614) inferred escape
                            TTTVPWNsSW gp160(605-614) inferred escape
                             TAVPWNASW gp160(606-614) B*35 human epitope
                             TAVPWNASW gp160(606-614) B*35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B35 human epitope
                             TAVPWNASW gp160(606-614) B*35:01 human epitope
                             TAVPWNASW gp160(606-614) B*35:01 human epitope
                             TAVPWNASW gp160(606-614) B*35:01 human epitope
                             TAVPWNSSW gp160(606-614) B*35:01 human epitope
                             TAVPWNASW gp160(606-614) B*35:01 human epitope
                             TAVPWNASW gp160(606-614) B*35:01, B*35:08 human epitope
                             TTVPWNVSW gp160(606-614) B*57:01 human epitope
                             TAVPWNASW gp160(606-614) B*58:01 human epitope
                             TAVPWNASW gp160(606-614) human epitope
                             TAVPWNSSW gp160(606-614) human epitope
                             TNVPWNSSW gp160(606-614) human epitope
                             TAVPWDSSW gp160(606-614) human epitope
                                     WSNKSQEEIWDNMTWMQW gp160(614-631) A*23:01 human epitope
                                     WSNKSQEDIWDNMTWMQW gp160(614-631) C*04 human epitope
                                     WnNKSQEDIWDNMTWMQW gp160(614-631) observed variant
                                     WSNKSQtDIWDNMTWMQW gp160(614-631) observed variant
                                     WSNKSQEDIWnNMTWMQW gp160(614-631) observed variant
                                     WSNKSQEeIWDNMTWMQW gp160(614-631) observed variant
                                     WSNKShEDIWDNMTWMQW gp160(614-631) observed variant
                                     WSNKSQsDIWDNMTWMQW gp160(614-631) observed variant
                                     WSNKSkEDIWDNMTWMQW gp160(614-631) observed variant
                                     WSNKSyEDIWDNMTWMQW gp160(614-631) observed variant
                                     WSNKSQEEIWDNMTWMQW gp160(614-631) C*04:01 human epitope
Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health