HIV molecular immunology database


Search the Epitope Variant and Escape Mutation Database

Results for CTL/CD8+ T-Cell Epitope Variants

Filter results by Mutation Type:

VWGIKQLQARILAVERYLKD gp160(570-589) DR1 human epitope
VWGIKQLQARVLAVERYLKD gp160(570-589) unclear
VWGIKQPQARVLAVERYLRD gp160(570-589) unclear
  GIKQLQTRVLAIERYLK gp160(572-588) C*06 human epitope
  GIKQLQARILAVERYLKDQ gp160(572-590) DPw4.2 human epitope
   IKQLQARVLAVERYL gp160(573-587) human epitope
     QLQARILAVERYLKDQQLLGIWGCS gp160(575-599) B14 human epitope
       QTRVLAIERYL gp160(577-587) B*58:01, B*58:02 human epitope
       QaRVLAIERYL gp160(577-587) susceptible form
       QTRVLAmERYL gp160(577-587) non-susceptible form
       QTRVLAlERYL gp160(577-587) susceptible form
       QTRVLAvERYL gp160(577-587) susceptible form
       QaRVLAmERYL gp160(577-587) susceptible form
       QTRVLAIERYL gp160(577-587) B*58:02 human epitope
       QTRVLAIERYL gp160(577-587) B*58:02 human epitope
       QTRVLAERYL gp160(577-587) B*58:02 human epitope
       QTRVLAIERYL gp160(577-587) B*58:02 human epitope
       QARILAVERYLKDQQLLGIWGCSGKLICTTAVPW gp160(577-610) mouse epitope
        ARVLAVERY gp160(578-586) B27 human epitope
        ARVLAVERYLRDQQL gp160(578-592) B*14:02 human epitope
        ARVLAVERYLkDQQL gp160(578-592) subtype-specific susceptible form
          VLALERYLKDQQL gp160(580-592) human epitope
          VLAVERYLKDQQLLGIWGCS gp160(580-599) human epitope
             VERYLKDQQL gp160(583-592) A*02:01 human epitope
             VERYLKDQQL gp160(583-592) B14 human epitope
             VERYLKDQQL gp160(583-592) B14 human epitope
             VERYLrDQQL gp160(583-592) observed variant
             VERYLRDQQLLGIWG gp160(583-597) A*23, A*24:02, B*08:01 human epitope
             VERYLkDQQLLGIWG gp160(583-597) subtype-specific susceptible form
              ERYLKDQQL gp160(584-592) A*23 human epitope
              ERYLKDQQL gp160(584-592) A*24 human epitope
              ERYLKDQQL gp160(584-592) A*32, B*14 human epitope
              ERYLKDQQL gp160(584-592) A*32, B*14 human epitope
              ERYLKDQQL gp160(584-592) A32 human epitope
              ERYLKDQQL gp160(584-592) A32, B14 human epitope
              ERYLrDQQL gp160(584-592) observed variant
              ERYLgDQQL gp160(584-592) observed variant
              ERYLqDQQL gp160(584-592) observed variant
              ERYLKDQQL gp160(584-592) B*08:01 human epitope
              ERYLKDQQL gp160(584-592) B*14 human epitope
              ERYLKDQQL gp160(584-592) B*14 human epitope
              ERYLrDQQL gp160(584-592) susceptible form
              ERYLqDQQL gp160(584-592) susceptible form
              EkYLqDQarl gp160(584-592) non-susceptible form
              EkYLKDQaQl gp160(584-592) diminished response; non-susceptible form
              ERYLqDQrL gp160(584-592) susceptible form
              ERYLKDQQL gp160(584-592) B*14 human epitope
              ERYLRDQQL gp160(584-592) B*14 human epitope
              ERYLRDQQL gp160(584-592) B*14 human epitope
              ERYLKDQQL gp160(584-592) B*14 human epitope
              ERYLKDQQL gp160(584-592) B*14 human epitope
              EKYLQDQAR gp160(584-592) B*14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLrDQQL gp160(584-592) subtype-specific susceptible form
              ERYLKDQQf gp160(584-592) subtype-specific non-susceptible form
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLRDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLqDQQL gp160(584-592) diminished response
              ERYLKDQQL gp160(584-592) B14 epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B14 human epitope
              ERYLKDQQL gp160(584-592) B*14:02, B14 human epitope
              ERYLrDQQL gp160(584-592) observed variant
              ERYLKDQQL gp160(584-592) B*14:02, B14 human epitope
              ERYLrDQQL gp160(584-592) susceptible form
              ERYLKDQQL gp160(584-592) B*14:01 human epitope
              ERYLRDQQL gp160(584-592) B*14:01 human epitope
              ERYLgDQQL gp160(584-592) observed variant
              ERhLRDQQL gp160(584-592) escape documented in this paper
              ERYLkDQQL gp160(584-592) observed variant
              ERYLsDQQL gp160(584-592) escape documented in this paper
              ERYLKDQQL gp160(584-592) B*14:02 human epitope
              ERYLRDQQL gp160(584-592) B*14:02 human epitope
              ERYLgDQQL gp160(584-592) inferred escape
              ERYLkDQQL gp160(584-592) inferred escape
              ERYLsDQQL gp160(584-592) inferred escape
              ERhLRDQQL gp160(584-592) inferred escape
              ERYLKDQQL gp160(584-592) B44 human epitope
              ERYLKDQQL gp160(584-592) human epitope
              ERYLKDQQL gp160(584-592) human epitope
              ERYLKDQQL gp160(584-592) human epitope
              ERYLKDQQL gp160(584-592) human epitope
              ERYLKDQQL gp160(584-592) human epitope
              ERYLKDQQL gp160(584-592) human epitope
              ERYLRDQQL gp160(584-592) human epitope
              ERYLKDQQL gp160(584-592) human epitope
              ERYLKeQQp gp160(584-592) observed variant
              ERYLrDQQL gp160(584-592) susceptible form
              ERYLtDQQL gp160(584-592) diminished response
              ERYLqDQQL gp160(584-592) diminished response
              ERYLsDQQL gp160(584-592) diminished response
              ERYLmDQQL gp160(584-592) diminished response
              ERYLmDQrL gp160(584-592) observed variant
              ERYLmDrQL gp160(584-592) observed variant
              ERYLmDQlL gp160(584-592) observed variant
              ERYLtDQrL gp160(584-592) observed variant
              ERYrtDQrL gp160(584-592) observed variant
              ERYLRDQQL gp160(584-592) human epitope
              ERYLkDQQL gp160(584-592) subtype-specific susceptible form
              ERsLRDQQL gp160(584-592) subtype-specific susceptible form
              ERYLKDQQLLG gp160(584-594) human epitope
              ERYLKDQQLLG gp160(584-594) human epitope
              ERYLrDQQLLG gp160(584-594) observed variant
              ERYLgDQQLLG gp160(584-594) observed variant
              ERYLqDQQLLG gp160(584-594) observed variant
               RYLRDQQL gp160(585-592) A*24:02 human epitope
               RYLKDQQL gp160(585-592) B27 human epitope
               RYLKDQQL gp160(585-592) B27 human epitope
               RYLKDQQLL gp160(585-593) A*02 human epitope
               RYLKDQQLL gp160(585-593) A*23 human epitope
               RYLKDQQLL gp160(585-593) A*23, A24 human epitope
               RYLrDQQLL gp160(585-593) observed variant
               RYLgDQQLL gp160(585-593) observed variant
               RYLqDQQLL gp160(585-593) observed variant
               RYLKDQQLL gp160(585-593) A23 human epitope
               RYLKDQQLL gp160(585-593) A*23:01 human epitope
               RYLKDQQLL gp160(585-593) A*23:01 human epitope
               RYLKDQQLL gp160(585-593) A*23:01, A*24:02 human epitope
               RYLKDQQLL gp160(585-593) A*24 human epitope
               RYLRDQQLL gp160(585-593) A*24 human epitope
               RYLRDQQgi gp160(585-593) observed variant
               RYLkDQQLL gp160(585-593) observed variant
               RYLRDQQLL gp160(585-593) A*24 human epitope
               RYLkDQQLL gp160(585-593) observed variant
               RYLKDQQLL gp160(585-593) A24 human epitope
               RYLKDQQLL gp160(585-593) A24 human epitope
               RYLKDQQLL gp160(585-593) A24 human epitope
               RYLKDQQLL gp160(585-593) A24 human epitope
               RYLKDQQLL gp160(585-593) A24 human epitope
               RYLKDQQLL gp160(585-593) A24 human epitope
               RYLKDQQLL gp160(585-593) A24 human epitope
               RYLKDQQLL gp160(585-593) A*24:02 human epitope
               RYLKDQQLL gp160(585-593) A*24:02 human epitope
               RYLRDQQLL gp160(585-593) A*24:02 human epitope
               RYLKDQQLL gp160(585-593) A*24:02 human epitope
               RYLKDQQLL gp160(585-593) A*29 human epitope
               RYLKDQQLL gp160(585-593) C*07:02 human epitope
               RYLKDQQLL gp160(585-593) C*14 human epitope
               RYLKDQQLL gp160(585-593) C*18 human epitope
               RYLKDQQLL gp160(585-593) human epitope
               RYLKDQQLL gp160(585-593) human epitope
               RYLKDQQLL gp160(585-593) human epitope
               RYLRDQQLLGI gp160(585-595) A*24:02 human epitope
               RYLRDQQLLGI gp160(585-595) A*24:02 human epitope
               RYLRDQQLLGI gp160(585-595) A*24:02 human epitope
                YLKDQQLL gp160(586-593) A*24 human epitope
                YLKDQQLL gp160(586-593) A*24 human epitope
                rYLKDQkLL gp160(586-593) subtype-specific non-susceptible form
                YLKDQQLL gp160(586-593) A*24, B*08 human epitope
                YLKDQQLL gp160(586-593) A24 human epitope
                YLKDQQLL gp160(586-593) A24 human epitope
                YLRDQQLL gp160(586-593) A24 human epitope
                YLRDQQLL gp160(586-593) A24 human epitope
                YLkDQQLL gp160(586-593) susceptible form
                YLKDQQLL gp160(586-593) A24 human epitope
                YLKDQQLL gp160(586-593) A24 human epitope
                YLKDQQLL gp160(586-593) A24, B8 human epitope
                YLKDQQLL gp160(586-593) A24, B8 human, macaque epitope
                YLKDQQLL gp160(586-593) A*24:02 human epitope
                YLKDQQLL gp160(586-593) B*08 human epitope
                YLrDQQLL gp160(586-593) escape documented in this paper
                YLQDQARL gp160(586-593) B*08 human epitope
                YLKDQQLL gp160(586-593) B*08 human epitope
                YLKDQQLL gp160(586-593) B*08 human epitope
                YLKDQQLL gp160(586-593) B*08:01 human epitope
                YLqDQQLL gp160(586-593) diminished HLA binding or increased off-rate; escape documented in this paper
                YLKDQQLL gp160(586-593) B*08:01 human epitope
                YLKDQQLL gp160(586-593) B*08:01 human epitope
                YLKDQQLL gp160(586-593) B8 epitope
                YLKDQQLL gp160(586-593) B8 human epitope
                YLKDQQLL gp160(586-593) B8 human epitope
                YLrDQQLL gp160(586-593) observed variant
                YLKgQQLL gp160(586-593) observed variant
                YLKDQQLL gp160(586-593) B8 human epitope
                YLKDQQLL gp160(586-593) B8 human epitope
                YLKDQQLL gp160(586-593) B8 human epitope
                YLRDQQLL gp160(586-593) human epitope
                YLKDQQLL gp160(586-593) human epitope
                YRLDQQLLGIWGC gp160(586-598) C*07 human epitope
                YLRDQQLLGIWGC gp160(586-598) Cw7 human epitope
                       LNSWGCAFRQVCHT gp160(593-606) human epitope
                       LNmWGCAFRQVCHT gp160(593-606) observed variant
                       LNlWGCAFRQVCHT gp160(593-606) observed variant
                       LNlWGCAaRQVCHT gp160(593-606) observed variant
                       LNmWGCAFRfVCHT gp160(593-606) observed variant
                       LNvWGCAFRhVCHT gp160(593-606) observed variant
                       LNSWGCAnRQVCHT gp160(593-606) observed variant
                       LGIWGCSGKLICTT gp160(593-606) human epitope
Questions or comments? Contact us at
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health