HIV molecular immunology database

 

Summary of Antibodies Mediating Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC)

This is a list of ADCC mediating antibodies, compiled in collaboration with Drs. Ferrari and Pollara (based on Pollara2013). The list provides links to both the whole antibody record (Database entry) and the record with only ADCC-related notes and references (ADCC notes).

Download this list of ADCC antibodies as CSV or XLS files.


Data last updated at 2022-05-05 09:25:31-06
MAb Name Author protein Binding type Discontinuous or linear Neutralizing Discontinuous contact residues Linear Epitope HXB2 location Database entry ADCC notes
13D7 Env gp120 C1 Linear     AAENLWVTVYYGVPV gp160(30-44) 2051 2051
                   
JR4 Env gp120 C1-C2         Env 3486 3486
                   
3BNC117 Env gp120 CD4BS   Yes 124P, 198T, 207K, 275V, 276N, 278T, 279D, 280N, 281A, 282K, 308R, 318V, 365S, 366G, 367G, 368D, 371I, 428Q, 429K, 430V, 455T, 456R, 457D, 458G, 459G, 460N, 461S, 462N, 469R, 473G   gp160 2586 2586
VRC-PG04 Env gp120 CD4BS   Yes 97K, 102E, 122L, 124P, 275V, 276N, 278T, 279D, 280N, 281A, 282K, 283T, 365S, 366G, 367G, 368D, 371I, 426M, 427W, 429K, 431G, 455T, 456R, 457D, 458G, 459G, 461S, 462N, 469R, 472G, 473G, 474D, 476R, 776L   Env 2571 2571
                   
19e Env gp120 CD4i         Env 1837 1837
                   
PG16 Env gp120 V2 // V2 glycan(V2g) // V2 apex   Yes 156N, 160N, 165I, 167G, 168K, 169V, 170Q, 171K, 173Y   Env 2125 2125
                   
10-1074 Env gp120 V3 // V3 glycan (V3g)   Yes 135K, 136N, 137D, 156N, 301N, 321G, 322K, 323I, 324G, 325N, 326M, 327R, 328Q, 329A, 330H, 332N, 415T, 416L, 417P   Env 2777 2777
KD-247 Env gp120 V3 // V3 glycan (V3g) Linear Yes   IGPGR gp160(311-315) 1593 1593
                   
10E8v4   C-term, gp41 MPER (membrane proximal external region) Linear Yes   NWFDISNWLWYIK gp160(671-683) 3508 3508
                   
CH89   gp120         Env 2871 2871
H003487   gp120         Env 2921 2921
H003488   gp120         Env 2922 2922
H003689   gp120         Env 2931 2931
H003794   gp120         Env 2933 2933
H003800   gp120         Env 2936 2936
H004296   gp120         Env 2938 2938
H004350   gp120         Env 2939 2939
                   
49G2   gp120 CD4BS   Yes     Env 3264 3264
NIH45-46   gp120 CD4BS   Yes 97K, 98N, 99D, 102E, 122L, 123T, 124P, 276N, 278T, 279D, 280N, 281A, 282K, 365S, 366G, 367G, 368D, 371I, 427W, 430V, 431G, 432K, 455T, 456R, 457D, 458G, 459G, 460N, 461S, 465S, 466E, 467I, 469R, 474D, 476R, 480R   Env 2580 2580
                   
916B2   gp120 CD4i   Yes     Env 3268 3268
917B11   gp120 CD4i   Yes     Env 3269 3269
N10-i5.3   gp120 CD4i         Env 2982 2982
                   
CAP228-16H   gp120 V1-V2   Yes     gp160 4026 4026
CAP228-19F   gp120 V1-V2   Yes     gp160 4027 4027
CAP228-3D   gp120 V1-V2   Yes     gp160 4028 4028
                   
VRC01-LS   gp120 V2-CD4BS   Yes     gp160 3313 3313
                   
16G6   gp120 V3 // V3 glycan (V3g)   Yes     Env 3259 3259
1D9   gp120 V3 // V3 glycan (V3g)   Yes     Env 3257 3257
717G2   gp120 V3 // V3 glycan (V3g)   Yes     Env 3260 3260
PGT121   gp120 V3 // V3 glycan (V3g) Discontinuous Yes     Env 2635 2635
PGT126   gp120 V3 // V3 glycan (V3g)   Yes     Env 2640 2640
                   
10E8   gp41 MPER (membrane proximal external region) Linear Yes 671N, 672W, 673F, 676T, 680W, 683K NWFDISNWLWYIK gp160(671-683) 2708 2708
LN01   gp41 MPER (membrane proximal external region)   Yes 671N, 673F, 674N, 676T, 677N, 680W, 683K, 687M   gp160 4140 4140
                   
m44 gp41 C-HR         Env 1916 1916
                   
PGT151 gp120-gp41 interface fusion peptide // near gp41-gp120 interface Discontinuous Yes     Env 3107 3107
PGT152 gp120-gp41 interface fusion peptide // near gp41-gp120 interface Discontinuous Yes     Env 3108 3108
                   
DH276 gp120 gp120   Yes     Env 3417 3417
DH640 gp120 gp120   Yes     Env 3724 3724
                   
m9 gp120 gp120 adjacent to CD4BS   Yes     Env 1619 1619
                   
DH280 gp120 gp120 C1   no     Env 3418 3418
DH284 gp120 gp120 C1   no     Env 3430 3430
DH382 gp120 gp120 C1   no     Env 3424 3424
DH383 gp120 gp120 C1   no     Env 3425 3425
                   
1E5 gp120 gp120 C1-C2   no     gp160 4143 4143
                   
C11 gp120 gp120 C1-C5, gp120 CD4i cluster A Discontinuous       Env 707 707
                   
CC6B5 gp120 gp120 C2   no     Env 3554 3554
GB1 gp120 gp120 C2   no     Env 3549 3549
                   
HH1G9 gp120 gp120 C2-C5   no     Env 3546 3546
                   
42F gp120 gp120 C5 Linear     IEPLGVAPTK gp160(491-500) 565 565
43F gp120 gp120 C5 Linear     IEPLGVAPTK gp160(491-500) 577 577
670-D gp120 gp120 C5 Discontinuous Yes   PTKAKRR gp160(498-504) 584 584
750-D gp120 gp120 C5         Env 586 586
                   
2G12 gp120 gp120 carbohydrates at glycosylation residues in C2, C3, C4, and V4, gp120 V3 // V3 glycan (V3g) Discontinuous Yes 295N, 297T, 332N, 334S, 386N, 388T, 392N, 394T, 448N, 450T   Env 1370 1370
                   
E51 gp120 gp120 CCR5BS, gp120 CD4i Linear Yes   IKQI gp160(420-423) 1254 1254
                   
1125H gp120 gp120 CD4BS Discontinuous Yes     Env 1275 1275
15e gp120 gp120 CD4BS Discontinuous Yes     Env 627 627
4-116 gp120 gp120 CD4BS         Env 2309 2309
448-D gp120 gp120 CD4BS Discontinuous Yes     Env 608 608
5145A gp120 gp120 CD4BS Discontinuous Yes     Env 629 629
b12 gp120 gp120 CD4BS Discontinuous Yes 256S, 257T, 280N, 281A, 364S, 365S, 366G, 367G, 368D, 369P, 370E, 371I, 372V, 373T, 384Y, 386N, 417P, 418C, 419R, 430V, 431G, 432K, 453L, 455T, 456R, 457D, 458G   Env 633 633
b6 gp120 gp120 CD4BS   no     Env 641 641
DH583 gp120 gp120 CD4BS         Env 3807 3807
F105 gp120 gp120 CD4BS Discontinuous Yes     Env 631 631
VRC01 gp120 gp120 CD4BS Discontinuous Yes 97K, 123T, 128S, 129L, 276N, 278T, 279D, 280N, 281A, 282K, 283T, 365S, 366G, 367G, 368D, 371I, 427W, 428Q, 429K, 430V, 455T, 456R, 457D, 458G, 459G, 460N, 461S, 462N, 463N, 464E, 465S, 469R, 472G, 473G, 474D, 476R   Env 2163 2163
                   
4-554 gp120 gp120 CD4i         Env 2354 2354
48d gp120 gp120 CD4i   Yes     Env 659 659
4E9C gp120 gp120 CD4i   Yes     Env 2477 2477
CH08 gp120 gp120 CD4i Discontinuous Yes     Env 2891 2891
N10-i4 gp120 gp120 CD4i Discontinuous       Env 3010 3010
N10-i6.1 gp120 gp120 CD4i Discontinuous       Env 3011 3011
X5 gp120 gp120 CD4i   Yes     Env 1121 1121
                   
A32 gp120 gp120 CD4i C1 (Cluster A) Discontinuous no     Env 660 660
                   
CH20 gp120 gp120 CD4i C1 region Discontinuous       Env 2869 2869
CH29 gp120 gp120 CD4i C1 region Discontinuous       Env 2874 2874
CH38 gp120 gp120 CD4i C1 region Discontinuous       Env 2880 2880
CH40 gp120 gp120 CD4i C1 region Discontinuous       Env 2888 2888
CH49 gp120 gp120 CD4i C1 region Discontinuous       Env 2881 2881
CH51 gp120 gp120 CD4i C1 region Discontinuous       Env 2883 2883
CH52 gp120 gp120 CD4i C1 region Discontinuous       Env 2885 2885
CH53 gp120 gp120 CD4i C1 region Discontinuous       Env 2886 2886
CH54 gp120 gp120 CD4i C1 region Discontinuous       Env 2882 2882
CH55 gp120 gp120 CD4i C1 region Discontinuous       Env 2884 2884
CH57 gp120 gp120 CD4i C1 region Discontinuous       Env 2879 2879
CH77 gp120 gp120 CD4i C1 region Discontinuous       Env 2870 2870
CH78 gp120 gp120 CD4i C1 region Discontinuous       Env 2875 2875
CH80 gp120 gp120 CD4i C1 region Discontinuous       Env 2873 2873
CH81 gp120 gp120 CD4i C1 region Discontinuous       Env 2887 2887
CH90 gp120 gp120 CD4i C1 region Discontinuous       Env 2877 2877
CH91 gp120 gp120 CD4i C1 region Discontinuous       Env 2878 2878
CH92 gp120 gp120 CD4i C1 region Discontinuous       Env 2872 2872
CH94 gp120 gp120 CD4i C1 region Discontinuous       Env 2876 2876
                   
L9-i1 gp120 gp120 CD4i cluster A Discontinuous       Env 2970 2970
L9-i2 gp120 gp120 CD4i cluster A Discontinuous       Env 2972 2972
N12-i3 gp120 gp120 CD4i cluster A Discontinuous       Env 2973 2973
N26-i1 gp120 gp120 CD4i cluster A Discontinuous       Env 2974 2974
N5-i5 gp120 gp120 CD4i cluster A Discontinuous       Env 2971 2971
                   
N12-i15 gp120 gp120 CD4i cluster B Discontinuous       Env 2975 2975
                   
L9-i3 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2976 2976
N10-i1.1 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2981 2981
N10-U1 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 3638 3638
N12-i1 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2983 2983
N12-i2 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2984 2984
N12-i4 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2985 2985
N12-i5 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2986 2986
N12-i7 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2987 2987
N12-i8 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2988 2988
N5-i1 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2977 2977
N5-i3 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2978 2978
N5-i4 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2979 2979
N5-i8 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 2980 2980
N5-U1 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 3636 3636
N5-U3 gp120 gp120 CD4i cluster C.1 Discontinuous Yes     Env 3637 3637
                   
N12-i10 gp120 gp120 CD4i cluster C.2 Discontinuous Yes     Env 2989 2989
N12-i17 gp120 gp120 CD4i cluster C.2 Discontinuous Yes     Env 2990 2990
N12-i18 gp120 gp120 CD4i cluster C.2 Discontinuous Yes     Env 2991 2991
N12-i19 gp120 gp120 CD4i cluster C.2 Discontinuous Yes     Env 2993 2993
                   
N10-i3.1 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 3000 3000
N12-i11 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 3003 3003
N12-i12 gp120 gp120 CD4i cluster C.3 Discontinuous       Env 3001 3001
N12-i9 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 3002 3002
N5-i12 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 2999 2999
N5-i14 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 2997 2997
N5-i2 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 2994 2994
N5-i6 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 2995 2995
N5-i7 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 2998 2998
N5-i9 gp120 gp120 CD4i cluster C.3 Discontinuous Yes     Env 2996 2996
                   
L9-i4 gp120 gp120 CD4i cluster C.4 Discontinuous       Env 3004 3004
N10-i2 gp120 gp120 CD4i cluster C.4 Discontinuous Yes     Env 3007 3007
N12-i14 gp120 gp120 CD4i cluster C.4 Discontinuous Yes     Env 3008 3008
N12-i16 gp120 gp120 CD4i cluster C.4 Discontinuous       Env 3009 3009
N5-i10.1 gp120 gp120 CD4i cluster C.4 Discontinuous       Env 3005 3005
N5-i13 gp120 gp120 CD4i cluster C.4 Discontinuous       Env 3006 3006
                   
17b gp120 gp120 CD4i CoRBS (Cluster C) Discontinuous Yes 419R, 421K, 422Q   Env 658 658
                   
DH285 gp120 gp120 V1-V2   Yes     Env 3428 3428
DH638 gp120 gp120 V1-V2   Yes     Env 3722 3722
DH641 gp120 gp120 V1-V2   Yes     Env 3723 3723
                   
C108G gp120 gp120 V2 // V2 glycan(V2g) // V2 apex Linear Yes   STSIRGKV gp160(162-169) 314 314
CH58 gp120 gp120 V2 // V2 glycan(V2g) // V2 apex Linear Yes   KKKVHALFYKLDIV gp160(169-182) 3019 3019
CH59 gp120 gp120 V2 // V2 glycan(V2g) // V2 apex Linear Yes   KKKVHALFYKLDIV gp160(169-182) 3020 3020
HG107 gp120 gp120 V2 // V2 glycan(V2g) // V2 apex Linear Yes     Env 3021 3021
HG120 gp120 gp120 V2 // V2 glycan(V2g) // V2 apex Linear Yes     Env 3022 3022
                   
PG9 gp120 gp120 V2 // V2 glycan(V2g) // V2 apex, quaternary structure Discontinuous Yes 156N, 160N, 165I, 167G, 168K, 169V, 170Q, 171K, 173Y   gp160 2124 2124
                   
0.5γ gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   SIHIGPGRAF gp160(308-317) 2475 2475
41148D gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   KRIHIGP gp160(305-313) 469 469
4117C gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   IXIGPGR gp160(309-315) 468 468
447-52D gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   GPGR gp160(312-315) 500 500
694/98-D gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   GRAF gp160(314-317) 506 506
C311E gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   RKRIHIGP gp160(304-313) 425 425
CH22 gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   RKRIHIGPGRAFYTT gp160(304-320) 2894 2894
CH23 gp120 gp120 V3 // V3 glycan (V3g) Linear Yes   NTRTSINIGPGQVFY gp160(302-318) 2895 2895
DH374 gp120 gp120 V3 // V3 glycan (V3g)   Yes     Env 3412 3412
DH377 gp120 gp120 V3 // V3 glycan (V3g)   Yes     Env 3415 3415
DH386 gp120 gp120 V3 // V3 glycan (V3g)   Yes     Env 3429 3429
TA6 gp120 gp120 V3 // V3 glycan (V3g)   Yes     Env 3556 3556
                   
M785-U1 gp41 gp41         gp160 3634 3634
                   
240-D gp41 gp41 cluster I Linear no   LLGIWGCSG gp160(592-600) 778 778
246-D gp41 gp41 cluster I Linear     QQLLGIWG gp160(590-597) 783 783
4B3 gp41 gp41 cluster I Linear     ARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNA ? gp160(578-612) 790 790
50-69 gp41 gp41 cluster I Discontinuous       Env 791 791
5-25 gp41 gp41 cluster I   no     Env 2392 2392
98-43 gp41 gp41 cluster I Linear     RILAVERYLKDQQLLGIWGCSGKLIC gp160(579-604) 775 775
F240 gp41 gp41 cluster I Linear     LLGIWGCSGKLICTT gp160(592-606) 777 777
                   
126-50 gp41 gp41 cluster II Discontinuous       Env 863 863
6-129 gp41 gp41 cluster II         Env 2399 2399
98-6 gp41 gp41 cluster II Discontinuous       Env 808 808
Fab D5 gp41 gp41 cluster II         Env 872 872
                   
120-16 gp41 gp41 MPER (membrane proximal external region) Linear     SLIEESQNQQEKNEQELLEL gp160(644-663) 806 806
2F5 gp41 gp41 MPER (membrane proximal external region) Linear Yes 662E, 663L, 664D, 665K, 666W, 667A ELDKWA gp160(662-667) 815 815
4E10 gp41 gp41 MPER (membrane proximal external region) Linear Yes 671N, 672W, 673F, 674N, 675I, 676T, 677N, 679L, 680W, 681Y NWFDIT gp160(671-676) 846 846
E10 gp41 gp41 MPER (membrane proximal external region) Linear Yes   QEKNEQELLEL gp160(653-663) 4016 4016
                   
HK20 gp120 gp41 NHR (N-heptad repeat) Linear Yes   QQHLLQLTVWGIKQL gp160(562-576) 2461 2461
                   
2.2C gp120           Env 2160 2160
31710B gp41           Env 905 905
4-133 gp120           Env 2314 2314
4-221 gp120           Env 2322 2322
CC6C11 gp120     no     Env 3555 3555
EA7 gp120     no     Env 3551 3551
EA8 gp120     no     Env 3552 3552
Fab 8066 gp41           Env 2062 2062
HH2D11 gp120     no     Env 3547 3547
HH4E4 gp120     no     Env 3548 3548
polyclonal gp120           Env 1625 1625

Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health