Search T Helper/CD4+ T-Cell Epitope Database

Found 3 matching records:

Displaying record number 201744

Download this epitope record as JSON.

HXB2 Location	Nef(112-127) DNA(9130..9177)	Nef Epitope Map
Author Location	Nef
Epitope	`LWVYHTQGYFPDWQNY`	Epitope Alignment
Epitope Name	OLP-82
Species (MHC/HLA)	human(DRB107:01, DRB113:01, DRB114:01, DRB301:01, DRB4*01:01)
Immunogen	HIV-1 infection
Country	United States
Experimental methods	CD4 T-cell Elispot - IFNγ, HLA binding
Keywords	binding affinity, immunodominance, HLA cross-presentation

Notes

67 Gag and Nef peptides restricted by HLA-DRB1 were characterized immunologically in 17 controllers and 9 progressors. HLA allele DRB1*15:02 was associated with low HIV-1 viremia and could promiscuously present peptides with lower avidity. HLA DRB1*03:01, however, was associated with high viremia and specific presentation of peptides. Moreover, Nef peptides were exclusively restricted by HLA-DRB1 variants linked with low viremia. Individuals with low viremia-linked HLA-DRB1 alleles also had greater breadth of HIV-specific CD4+ T cell responses. DRB1 allelic expression can impact HIV replication.
Overlapping peptide-82 (OLP-82), LWVYHTQGYFPDWQNY, was promiscuous as it was restricted by 5 different HLA-DR across the HIV proteome as determined by IFN-γ EliSpot.

References

Ranasinghe2013 Srinika Ranasinghe, Sam Cutler, Isaiah Davis, Richard Lu, Damien Z. Soghoian, Ying Qi, John Sidney, Gregory Kranias, Michael D. Flanders, Madelene Lindqvist, Bjorn Kuhl, Galit Alter, Steven G. Deeks, Bruce D. Walker, Xiaojiang Gao, Alessandro Sette, Mary Carrington, and Hendrik Streeck. Association of HLA-DRB1-Restricted CD4+ T Cell Responses with HIV Immune Control. Nat. Med., 19(7):930-933, Jul 2013. PubMed ID: 23793098. Show all entries for this paper.

Displaying record number 201039

Download this epitope record as JSON.

HXB2 Location	Nef(112-127) DNA(9130..9177)	Nef Epitope Map
Author Location	Nef(112-127 B Consensus)
Epitope	`LWVYHTQGYFPDWQNY`	Epitope Alignment
Subtype	B
Species (MHC/HLA)	human
Immunogen	HIV-1 infection
Country	United States
Experimental methods	CD4 T-cell Elispot - IFNγ, HLA binding, Intracellular cytokine staining
Keywords	supervised treatment interruptions (STI), rate of progression, immunodominance, acute/early infection

Notes

CD4 T-cell responses in 36 HIV-1 positive individuals in different disease stages were mapped by IFN-γ EliSpot using a panel of 410 B-consensus peptides spanning all HIV proteins. Virus specific CD4+ T-cell responses (median=7, range of magnitude=990) were detected in 30/36 patients.
This peptide was recognized by 14% of the study group.
Gag and Nef responses dominated the CD4+ T-cell EliSpot responses in the study. No correlation between plasma viremia and the frequency or magnitude of HIV-1-specific responses was observed.
The most HIV-1 specific CD4+ T-cell responses were observed in acutely infected patients with treatment of primary infection who stopped after 1-3 treatments (acute STI), compared to patients continuing therapy. People with therapy during chronic infection had low responses; higher numbers of responses were seen among untreated people. 2/9 LTNPs responded to many peptides, comparable to acute STI.

References

Kaufmann2004 Daniel E. Kaufmann, Paul M. Bailey, John Sidney, Bradford Wagner, Philip J. Norris, Mary N. Johnston, Lisa A. Cosimi, Marylyn M. Addo, Mathias Lichterfeld, Marcus Altfeld, Nicole Frahm, Christian Brander, Alessandro Sette, Bruce D. Walker, and Eric S. Rosenberg. Comprehensive Analysis of Human Immunodeficiency Virus Type 1-Specific CD4 Responses Reveals Marked Immunodominance of gag and nef and the Presence of Broadly Recognized Peptides. J. Virol., 78(9):4463-4477, May 2004. PubMed ID: 15078927. Show all entries for this paper.

Displaying record number 201389

Download this epitope record as JSON.

HXB2 Location	Nef(112-127) DNA(9130..9177)	Nef Epitope Map
Author Location	Nef(112-127)
Epitope	`LWVYHTQGYFPDWQNY`	Epitope Alignment
Species (MHC/HLA)	human
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
LWVYHTQGYFPDWQNY is a previously known epitope that is a part of TCI fragment IHSQKRQDILDLWVYHTQGYFPDWQNYTPGPGIRYPLTFGWCYKLVP in this vaccine construct.

References

Bazhan2008 Sergei I. Bazhan, Larisa I. Karpenko, Leonid R. Lebedev, Roman V. Uzhachenko, Pavel A. Belavin, Alexey M. Eroshkin, and Alexander A. Ilyichev. A Synergistic Effect of a Combined Bivalent DNA-Protein Anti-HIV-1 Vaccine Containing Multiple T- and B-Cell Epitopes of HIV-1 Proteins. Mol. Immunol., 45(3):661-669, Feb 2008. PubMed ID: 17869341. Show all entries for this paper.