HIV molecular immunology database
Found 23 matching records:
Download this epitope record as JSON.
HXB2 Location | gp160(102-116) gp120(102-116) DNA(6528..6572) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(109-123 IIIB) | |
Epitope |
EQMHEDIISLWDQSL
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2d) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(102-121) gp120(102-121) DNA(6528..6587) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(109-128 IIIB) | |
Epitope |
EQMHEDIISLWDQSLKPCVK
|
Epitope Alignment
|
Species (MHC/HLA) | human, mouse(H-2k, H-2s) | |
Immunogen | HIV-1 infection, vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(105-117) gp120(105-117) DNA(6537..6575) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(112-124 IIIB) | |
Epitope |
HEDIISLWDQSLK
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2k) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(317-331) gp120(317-331) DNA(7173..7217) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(324-338 IIIB) | |
Epitope |
FVTIGKIGNMRQAHC
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2d, H-2k) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(317-349) gp120(317-349) DNA(7173..7271) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(324-356 IIIB) | |
Epitope |
FVTIGKIGNMRQAHCNISRAKWNNTLKQIDSKL
|
Epitope Alignment |
Species (MHC/HLA) | human, mouse(H-2d, H-2k) | |
Immunogen | HIV-1 infection, vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(335-349) gp120(335-349) DNA(7227..7271) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(342-356 IIIB) | |
Epitope |
RAKWNNTLKQIDSKL
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(421-436) gp120(421-436) DNA(7485..7532) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(428-443 IIIB) | |
Epitope |
KQIINMWQEVGKAMYA
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2d, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(421-444) gp120(421-444) DNA(7485..7556) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(428-451 IIIB) | |
Epitope |
KQIINMWQEVGKAMYAPPISGQIR
|
Epitope Alignment |
Species (MHC/HLA) | human, mouse(H-2b, H-2d, H-2k, H-2s) | |
Immunogen | HIV-1 infection, vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(425-439) gp120(425-439) DNA(7497..7541) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(432-446 IIIB) | |
Epitope |
NMWQEVGKAMYAPPI
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(430-444) gp120(430-444) DNA(7512..7556) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(437-451 IIIB) | |
Epitope |
VGKAMYAPPISGQIR
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2d, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(476-490) gp120(476-490) DNA(7650..7694) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(483-497 IIIB) | |
Epitope |
RDNWRSELYKYKVVK
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(476-499) gp120(476-499) DNA(7650..7721) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(483-506 IIIB) | |
Epitope |
RDNWRSELYKYKVVKIEPLGVAPT
|
Epitope Alignment |
Species (MHC/HLA) | human, mouse(H-2b, H-2d, H-2k, H-2s) | |
Immunogen | HIV-1 infection, vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(485-499) gp120(485-499) DNA(7677..7721) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(492-506 IIIB) | |
Epitope |
KYKVVKIEPLGVAPT
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2d, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(780-794) gp41(269-283) DNA(8562..8606) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(787-801 IIIB) | |
Epitope |
RIVELLGRRGWEALK
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2d, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(780-813) gp41(269-302) DNA(8562..8663) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(787-820 IIIB) | |
Epitope |
RIVELLGRRGWEALKYWWNLLQYWSQELKNSAVS
|
Epitope Alignment |
Species (MHC/HLA) | mouse(H-2k) | |
Immunogen | HIV-1 infection, vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(794-808) gp41(283-297) DNA(8604..8648) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(801-815 IIIB) | |
Epitope |
KYWWNLLQYWSQELK
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2d, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(799-813) gp41(288-302) DNA(8619..8663) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(806-820 IIIB) | |
Epitope |
LLQYWSQELKNSAVS
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2d, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(821-835) gp41(310-324) DNA(8685..8729) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(828-842 IIIB) | |
Epitope |
AVAEGTDRVIEVVQG
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(821-853) gp41(310-342) DNA(8685..8783) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(828-860 IIIB) | |
Epitope |
AVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLER
|
Epitope Alignment |
Species (MHC/HLA) | human, mouse(H-2b, H-2d, H-2k, H-2s) | |
Immunogen | HIV-1 infection, vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(827-841) gp41(316-330) DNA(8703..8747) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(834-848 IIIB) | |
Epitope |
DRVIEVVQGAYRAIR
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2k) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(829-843) gp41(318-332) DNA(8709..8753) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(836-850 IIIB) | |
Epitope |
VIEVVQGAYRAIRHI
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2k) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(834-848) gp41(323-337) DNA(8724..8768) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(841-855 IIIB) | |
Epitope |
QGAYRAIRHIPRRIR
|
Epitope Alignment
|
Species (MHC/HLA) | mouse(H-2b, H-2d, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.
Download this epitope record as JSON.
HXB2 Location | gp160(839-853) gp41(328-342) DNA(8739..8783) |
gp160 Epitope Map |
---|---|---|
Author Location | gp160(828-842 IIIB) | |
Epitope |
AIRHIPRRIRQGLER
|
Epitope Alignment
|
Species (MHC/HLA) | human, mouse(H-2b, H-2k, H-2s) | |
Immunogen | vaccine | |
Experimental methods | ||
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade IIIB |
Vaccine component | gp160 |
Adjuvant | Complete Freund's Adjuvant (CFA) |
Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.
Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.