logo image

HIV Molecular Immunology Database

Search T Helper/CD4+ T-Cell Epitope Database

Found 23 matching records:

Displaying record number 446

Download this epitope record as JSON.

HXB2 Location Env(102-116)
gp120(102-116)
DNA(6528..6572)
Env Epitope Map
Author Location gp160(109-123 IIIB)
Epitope EQMHEDIISLWDQSL Epitope Alignment
EQMHEDIISLWDQSL epitope logo
Species (MHC/HLA) mouse(H-2b, H-2d)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 447

Download this epitope record as JSON.

HXB2 Location Env(102-121)
gp120(102-121)
DNA(6528..6587)
Env Epitope Map
Author Location gp160(109-128 IIIB)
Epitope EQMHEDIISLWDQSLKPCVK Epitope Alignment
EQMHEDIISLWDQSLKPCVK epitope logo
Species (MHC/HLA) human, mouse(H-2k, H-2s)
Immunogen HIV-1 infection, vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 445

Download this epitope record as JSON.

HXB2 Location Env(105-117)
gp120(105-117)
DNA(6537..6575)
Env Epitope Map
Author Location gp160(112-124 IIIB)
Epitope HEDIISLWDQSLK Epitope Alignment
HEDIISLWDQSLK epitope logo
Species (MHC/HLA) mouse(H-2k)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 449

Download this epitope record as JSON.

HXB2 Location Env(317-331)
gp120(317-331)
DNA(7173..7217)
Env Epitope Map
Author Location gp160(324-338 IIIB)
Epitope FVTIGKIGNMRQAHC Epitope Alignment
FVTIGKIGNMRQAHC epitope logo
Species (MHC/HLA) mouse(H-2d, H-2k)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 448

Download this epitope record as JSON.

HXB2 Location Env(317-349)
gp120(317-349)
DNA(7173..7271)
Env Epitope Map
Author Location gp160(324-356 IIIB)
Epitope FVTIGKIGNMRQAHCNISRAKWNNTLKQIDSKL Epitope Alignment
Species (MHC/HLA) human, mouse(H-2d, H-2k)
Immunogen HIV-1 infection, vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 450

Download this epitope record as JSON.

HXB2 Location Env(335-349)
gp120(335-349)
DNA(7227..7271)
Env Epitope Map
Author Location gp160(342-356 IIIB)
Epitope RAKWNNTLKQIDSKL Epitope Alignment
RAKWNNTLKQIDSKL epitope logo
Species (MHC/HLA) mouse(H-2b, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 452

Download this epitope record as JSON.

HXB2 Location Env(421-436)
gp120(421-436)
DNA(7485..7532)
Env Epitope Map
Author Location gp160(428-443 IIIB)
Epitope KQIINMWQEVGKAMYA Epitope Alignment
KQIINMWQEVGKAMYA epitope logo
Species (MHC/HLA) mouse(H-2d, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 451

Download this epitope record as JSON.

HXB2 Location Env(421-444)
gp120(421-444)
DNA(7485..7556)
Env Epitope Map
Author Location gp160(428-451 IIIB)
Epitope KQIINMWQEVGKAMYAPPISGQIR Epitope Alignment
Species (MHC/HLA) human, mouse(H-2b, H-2d, H-2k, H-2s)
Immunogen HIV-1 infection, vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 453

Download this epitope record as JSON.

HXB2 Location Env(425-439)
gp120(425-439)
DNA(7497..7541)
Env Epitope Map
Author Location gp160(432-446 IIIB)
Epitope NMWQEVGKAMYAPPI Epitope Alignment
NMWQEVGKAMYAPPI epitope logo
Species (MHC/HLA) mouse(H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 454

Download this epitope record as JSON.

HXB2 Location Env(430-444)
gp120(430-444)
DNA(7512..7556)
Env Epitope Map
Author Location gp160(437-451 IIIB)
Epitope VGKAMYAPPISGQIR Epitope Alignment
VGKAMYAPPISGQIR epitope logo
Species (MHC/HLA) mouse(H-2b, H-2d, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 456

Download this epitope record as JSON.

HXB2 Location Env(476-490)
gp120(476-490)
DNA(7650..7694)
Env Epitope Map
Author Location gp160(483-497 IIIB)
Epitope RDNWRSELYKYKVVK Epitope Alignment
RDNWRSELYKYKVVK epitope logo
Species (MHC/HLA) mouse(H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 455

Download this epitope record as JSON.

HXB2 Location Env(476-499)
gp120(476-499)
DNA(7650..7721)
Env Epitope Map
Author Location gp160(483-506 IIIB)
Epitope RDNWRSELYKYKVVKIEPLGVAPT Epitope Alignment
Species (MHC/HLA) human, mouse(H-2b, H-2d, H-2k, H-2s)
Immunogen HIV-1 infection, vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 457

Download this epitope record as JSON.

HXB2 Location Env(485-499)
gp120(485-499)
DNA(7677..7721)
Env Epitope Map
Author Location gp160(492-506 IIIB)
Epitope KYKVVKIEPLGVAPT Epitope Alignment
KYKVVKIEPLGVAPT epitope logo
Species (MHC/HLA) mouse(H-2b, H-2d, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 459

Download this epitope record as JSON.

HXB2 Location Env(780-794)
gp41(269-283)
DNA(8562..8606)
Env Epitope Map
Author Location gp160(787-801 IIIB)
Epitope RIVELLGRRGWEALK Epitope Alignment
RIVELLGRRGWEALK epitope logo
Species (MHC/HLA) mouse(H-2d, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 458

Download this epitope record as JSON.

HXB2 Location Env(780-813)
gp41(269-302)
DNA(8562..8663)
Env Epitope Map
Author Location gp160(787-820 IIIB)
Epitope RIVELLGRRGWEALKYWWNLLQYWSQELKNSAVS Epitope Alignment
Species (MHC/HLA) mouse(H-2k)
Immunogen HIV-1 infection, vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 460

Download this epitope record as JSON.

HXB2 Location Env(794-808)
gp41(283-297)
DNA(8604..8648)
Env Epitope Map
Author Location gp160(801-815 IIIB)
Epitope KYWWNLLQYWSQELK Epitope Alignment
KYWWNLLQYWSQELK epitope logo
Species (MHC/HLA) mouse(H-2d, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 461

Download this epitope record as JSON.

HXB2 Location Env(799-813)
gp41(288-302)
DNA(8619..8663)
Env Epitope Map
Author Location gp160(806-820 IIIB)
Epitope LLQYWSQELKNSAVS Epitope Alignment
LLQYWSQELKNSAVS epitope logo
Species (MHC/HLA) mouse(H-2d, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 463

Download this epitope record as JSON.

HXB2 Location Env(821-835)
gp41(310-324)
DNA(8685..8729)
Env Epitope Map
Author Location gp160(828-842 IIIB)
Epitope AVAEGTDRVIEVVQG Epitope Alignment
AVAEGTDRVIEVVQG epitope logo
Species (MHC/HLA) mouse(H-2b, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 462

Download this epitope record as JSON.

HXB2 Location Env(821-853)
gp41(310-342)
DNA(8685..8783)
Env Epitope Map
Author Location gp160(828-860 IIIB)
Epitope AVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLER Epitope Alignment
Species (MHC/HLA) human, mouse(H-2b, H-2d, H-2k, H-2s)
Immunogen HIV-1 infection, vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 464

Download this epitope record as JSON.

HXB2 Location Env(827-841)
gp41(316-330)
DNA(8703..8747)
Env Epitope Map
Author Location gp160(834-848 IIIB)
Epitope DRVIEVVQGAYRAIR Epitope Alignment
DRVIEVVQGAYRAIR epitope logo
Species (MHC/HLA) mouse(H-2b, H-2k)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 465

Download this epitope record as JSON.

HXB2 Location Env(829-843)
gp41(318-332)
DNA(8709..8753)
Env Epitope Map
Author Location gp160(836-850 IIIB)
Epitope VIEVVQGAYRAIRHI Epitope Alignment
VIEVVQGAYRAIRHI epitope logo
Species (MHC/HLA) mouse(H-2b, H-2k)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 466

Download this epitope record as JSON.

HXB2 Location Env(834-848)
gp41(323-337)
DNA(8724..8768)
Env Epitope Map
Author Location gp160(841-855 IIIB)
Epitope QGAYRAIRHIPRRIR Epitope Alignment
QGAYRAIRHIPRRIR epitope logo
Species (MHC/HLA) mouse(H-2b, H-2d, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


Displaying record number 467

Download this epitope record as JSON.

HXB2 Location Env(839-853)
gp41(328-342)
DNA(8739..8783)
Env Epitope Map
Author Location gp160(828-842 IIIB)
Epitope AIRHIPRRIRQGLER Epitope Alignment
AIRHIPRRIRQGLER epitope logo
Species (MHC/HLA) human, mouse(H-2b, H-2k, H-2s)
Immunogen vaccine
Experimental methods  
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component gp160
Adjuvant Complete Freund's Adjuvant (CFA)

Notes

References

Berzofsky1991 J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Peptides containing multideterminant clusters of human immunodeficiency virus envelope induce murine and human T-cell responses in diverse histocompatibility types. Trans. Assoc. Am. Physicians, 104:69-77, 1991. PubMed ID: 1845157. Show all entries for this paper.

Berzofsky1991a J. A. Berzofsky, C. D. Pendleton, M. Clerici, J. Ahlers, D. R. Lucey, S. D. Putney, and G. M. Shearer. Construction of peptides encompassing multideterminant clusters of human immunodeficiency virus envelope to induce in vitro T cell responses in mice and humans of multiple MHC types. J. Clin. Invest., 88(3):876-84, Sep 1991. PubMed ID: 1715888. Show all entries for this paper.


This is a legacy search page. It is deprecated, will receive no more updates, and will eventually be removed. Please use the new search pages.

Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Copyright Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services LANL logo National Institutes of Health logo