Search T Helper/CD4+ T-Cell Epitope Database

Found 23 matching records:

Displaying record number 201361

Download this epitope record as JSON.

HXB2 Location	Gag(21-35) p17(21-35) DNA(850..894)	Gag Epitope Map
Author Location	p17(21-35)
Epitope	`LRPGGKKKYKLKHIV`	Epitope Alignment
Species (MHC/HLA)	human(DR13.02)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
LRPGGKKKYKLKHIV is a previously known epitope that is a part of TCI fragment KIRLRPGGKKKYKLKHIVWASRELERFAVN in this vaccine construct.

References

Bazhan2008 Sergei I. Bazhan, Larisa I. Karpenko, Leonid R. Lebedev, Roman V. Uzhachenko, Pavel A. Belavin, Alexey M. Eroshkin, and Alexander A. Ilyichev. A Synergistic Effect of a Combined Bivalent DNA-Protein Anti-HIV-1 Vaccine Containing Multiple T- and B-Cell Epitopes of HIV-1 Proteins. Mol. Immunol., 45(3):661-669, Feb 2008. PubMed ID: 17869341. Show all entries for this paper.

Displaying record number 201362

Download this epitope record as JSON.

HXB2 Location	Gag(32-46) p17(32-46) DNA(883..927)	Gag Epitope Map
Author Location	p17(32-46)
Epitope	`KHIVWASRELERFAV`	Epitope Alignment
Species (MHC/HLA)	human
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
KHIVWASRELERFAV is a previously known epitope that is a part of TCI fragment KIRLRPGGKKKYKLKHIVWASRELERFAVN in this vaccine construct.

References

Displaying record number 201363

Download this epitope record as JSON.

HXB2 Location	Gag(39-47) p17(39-47) DNA(904..930)	Gag Epitope Map
Author Location	p17(39-47)
Epitope	`RELERFAVN`	Epitope Alignment
Species (MHC/HLA)	human(DRB1*13:02)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
RELERFAVN is a previously known epitope that is a part of TCI fragment KIRLRPGGKKKYKLKHIVWASRELERFAVN in this vaccine construct.

References

Displaying record number 201379

Download this epitope record as JSON.

HXB2 Location	Gag(253-272) p24(121-140) DNA(1546..1605)	Gag Epitope Map
Author Location	p24(121-140)
Epitope	`NPPIPVGEIYKRWIILGLNK`	Epitope Alignment
Species (MHC/HLA)	mouse(H-2^d)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
NPPIPVGEIYKRWIILGLNK is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201364

Download this epitope record as JSON.

HXB2 Location	Gag(259-273) p24(127-141) DNA(1564..1608)	Gag Epitope Map
Author Location	p24(127-141)
Epitope	`GEIYRWIILGLNKI`	Epitope Alignment
Species (MHC/HLA)	human(DR supermotif)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
GEIYRWIILGLNKI is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201365

Download this epitope record as JSON.

HXB2 Location	Gag(260-269) p24(128-137) DNA(1567..1596)	Gag Epitope Map
Author Location	p24(128-137)
Epitope	`EIYRWIILG`	Epitope Alignment
Species (MHC/HLA)	human(DRB113:01, DRB113:02)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
EIYRWIILG is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201366

Download this epitope record as JSON.

HXB2 Location	Gag(261-280) p24(129-148) DNA(1570..1629)	Gag Epitope Map
Author Location	p24(129-148)
Epitope	`IYKRWIILGLNKIVRMYSPT`	Epitope Alignment
Species (MHC/HLA)	human
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
IYRWIILGLNKIVRMYSPT is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201368

Download this epitope record as JSON.

HXB2 Location	Gag(263-277) p24(131-145) DNA(1576..1620)	Gag Epitope Map
Author Location	p24(131-145)
Epitope	`KRWIILGLNKIVRMY`	Epitope Alignment
Species (MHC/HLA)	human(DR supermotif)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
KRWIILGLNKIVRMY is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201369

Download this epitope record as JSON.

HXB2 Location	Gag(265-276) p24(133-144) DNA(1582..1617)	Gag Epitope Map
Author Location	p24(133-144)
Epitope	`WIILGLNKIVRM`	Epitope Alignment
Species (MHC/HLA)	human(DRB101:01, DRB104:01, DRB104:05, DRB111:01, DRB113:02, DRB115:01, DRB5*01:01)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
KRWIILGLNKIVRMY is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201377

Download this epitope record as JSON.

HXB2 Location	Gag(265-282) p24(133-150) DNA(1582..1635)	Gag Epitope Map
Author Location	p24(133-150)
Epitope	`WIILGLNKIVRMYSPTSI`	Epitope Alignment
Species (MHC/HLA)	human(DRB107:01, DRB111:01, DRB113:02, DRB115:01, DRB5*01:01)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
WIILGLNKIVRMYSPTSI is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201378

Download this epitope record as JSON.

HXB2 Location	Gag(267-277) p24(135-145) DNA(1588..1620)	Gag Epitope Map
Author Location	p24(135-145)
Epitope	`ILGLNKIVRMY`	Epitope Alignment
Species (MHC/HLA)	human(DRB104:01, DRB113:02, DRB1*15:01)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
ILGLNKIVRMY is a previously known epitope that is a part of TCI fragment NPPIPVGEIYRWIILGLNKIVRMYSPTSI in this vaccine construct.

References

Displaying record number 201385

Download this epitope record as JSON.

HXB2 Location	Pol(191-207) RT(36-52) DNA(2655..2705)	Pol Epitope Map
Author Location	RT(36-52)
Epitope	`EICTEMEKEGKISKIGP`	Epitope Alignment
Species (MHC/HLA)	human
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
EICTEMEKEGKISKIGP is a previously known epitope that is a part of this vaccine construct.

References

Displaying record number 201386

Download this epitope record as JSON.

HXB2 Location	Pol(311-325) RT(156-170) DNA(3015..3059)	Pol Epitope Map
Author Location	RT(156-170)
Epitope	`SPAIFQCSSMTKILEP`	Epitope Alignment
Species (MHC/HLA)	human(DR supermotif)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
SPAIFQCSSMTKILEP is a previously known epitope that is a part of TCI fragment WKGSPAIFQCSSMTKILEPFRKQNPDIVIYQYMDDL in this vaccine construct.

References

Displaying record number 201380

Download this epitope record as JSON.

HXB2 Location	gp160(41-60) gp120(41-60) DNA(6345..6404)	gp160 Epitope Map
Author Location	gp120(41-60)
Epitope	`GVPVWKEATTTLFCASDAKA`	Epitope Alignment
Species (MHC/HLA)	mouse(H-2^d)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
GVPVWKEATTTLFCASDAKA is a previously known epitope that is a part of TCI fragment TVYYGVPVWKEATTTLFCASDAKAY in this vaccine construct.

References

Displaying record number 201359

Download this epitope record as JSON.

HXB2 Location	gp160(421-436) gp120(421-436) DNA(7485..7532)	gp160 Epitope Map
Author Location
Epitope	`KQIINMWQEVGKAMYA`	Epitope Alignment
Epitope Name	N16
Species (MHC/HLA)	mouse(H-2^d)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
Peptide N16, KQIINMWQEVGKAMYA, was used as a specific antigen for ELISpot positive control. N16 was previously known to induce T-helper responses not only in mice but also in humans and monkeys. It is a previously known epitope that is a part of TCI fragment RIKQIINMWQEVGKAMYAPPISGQIR in this vaccine construct.

References

Displaying record number 201381

Download this epitope record as JSON.

HXB2 Location	gp160(430-444) gp120(430-444) DNA(7512..7556)	gp160 Epitope Map
Author Location	gp120(430-444)
Epitope	`VGKAMYAPPISGQIR`	Epitope Alignment
Species (MHC/HLA)	mouse(H-2^d, H-2^k)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
VGKAMYAPPISGQIR is a previously known epitope that is a part of TCI fragment RIKQIINMWQEVGKAMYAPPISGQIR in this vaccine construct.

References

Displaying record number 201282

Download this epitope record as JSON.

HXB2 Location	gp160(827-841) gp41(316-330) DNA(8703..8747)	gp160 Epitope Map
Author Location	gp41(827-841)
Epitope	`DRVIEVVQGAYRAIR`	Epitope Alignment
Epitope Name	N15
Species (MHC/HLA)	mouse(H-2^b, H-2^k)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
Peptide N15, DRVIEVVQGAYRAIR, was used as a specific antigen for ELISpot positive control. N15 was previously known to induce T-helper responses not only in mice but also in humans and monkeys. It is a previously known epitope that is a part of TCI fragment SLLNATDIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL in this vaccine construct.

References

Displaying record number 201382

Download this epitope record as JSON.

HXB2 Location	gp160(834-848) gp41(323-337) DNA(8724..8768)	gp160 Epitope Map
Author Location	gp41(834-848)
Epitope	`QGAYRAIRHIPRRIR`	Epitope Alignment
Species (MHC/HLA)	mouse(H-2^b, H-2^d, H-2^k, H-2^s)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
QGAYRAIRHIPRRIR is a previously known epitope that is a part of TCI fragment SLLNATDIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL in this vaccine construct.

References

Displaying record number 201383

Download this epitope record as JSON.

HXB2 Location	gp160(839-848) gp41(328-337) DNA(8739..8768)	gp160 Epitope Map
Author Location	gp41(839-848)
Epitope	`AIRHIPRRIR`	Epitope Alignment
Species (MHC/HLA)	mouse(H-2^d, H-2^t4)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
AIRHIPRRIR is a previously known epitope that is a part of TCI fragment SLLNATDIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL in this vaccine construct.

References

Displaying record number 201384

Download this epitope record as JSON.

HXB2 Location	gp160(839-853) gp41(328-342) DNA(8739..8783)	gp160 Epitope Map
Author Location	gp41(839-853)
Epitope	`AIRHIPRRIRQGLER`	Epitope Alignment
Species (MHC/HLA)	mouse(H-2^d, H-2^t4)
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
AIRHIPRRIRQGLER is a previously known epitope that is a part of TCI fragment SLLNATDIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL in this vaccine construct.

References

Displaying record number 201387

Download this epitope record as JSON.

HXB2 Location	Nef(81-97) DNA(9037..9087)	Nef Epitope Map
Author Location	Nef(81-97)
Epitope	`YKAAVDLSHFLKEKGGL`	Epitope Alignment
Species (MHC/HLA)	human
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
YKAAVDLSHFLKEKGGL is a previously known epitope that is a part of TCI fragment FPVRPQVPLRPMTYKAAVDLSHFLKEKGGLEGL in this vaccine construct.

References

Displaying record number 201388

Download this epitope record as JSON.

HXB2 Location	Nef(104-121) DNA(9106..9159)	Nef Epitope Map
Author Location	Nef(104-121)
Epitope	`QKRQDILDLWVYHTQGYF`	Epitope Alignment
Species (MHC/HLA)	human
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
QKRQDILDLWVYHTQGYF is a previously known epitope that is a part of TCI fragment IHSQKRQDILDLWVYHTQGYFPDWQNYTPGPGIRYPLTFGWCYKLVP in this vaccine construct.

References

Displaying record number 201389

Download this epitope record as JSON.

HXB2 Location	Nef(112-127) DNA(9130..9177)	Nef Epitope Map
Author Location	Nef(112-127)
Epitope	`LWVYHTQGYFPDWQNY`	Epitope Alignment
Species (MHC/HLA)	human
Immunogen	vaccine
Country	Russia
Experimental methods	T-cell Elispot
Keywords	vaccine antigen design

Vaccine Details

Vaccine type	DNA, virus-like particle (VLP), HIV infected-cell lysate, polyepitope
Vaccine component	Env, Gag, Nef, Pol

Notes

Two immunogens were combined in the CombiHIV vac (VLP-TBI-pcDNATCI) vaccine: artificial polyepitope protein TBI, containing T- and B-cell epitopes from Env and Gag and the DNA vaccine construct pcDNA-TCI, carrying CTL and CD4+ epitopes from Env, Gag, Pol, Nef.
Combination of two B- and T-cell immunogens resulted in increase in the antibody response (but not CTL response) to both TBI protein and the proteins from HIV-1 lysate, compared to the level of antibodies induced by immunization with either immunogen alone. The synergistic effect in the induction of B-cell-mediated response was explained by the presence of CD4+ T-helper epitopes in TCI, due to stimulation of B-cell proliferation and differentiation.
LWVYHTQGYFPDWQNY is a previously known epitope that is a part of TCI fragment IHSQKRQDILDLWVYHTQGYFPDWQNYTPGPGIRYPLTFGWCYKLVP in this vaccine construct.