HIV molecular immunology database

 

Search CTL/CD8+ T-Cell Epitope Database

Found 181 matching records:

Displaying record number 62993

Download this epitope record as JSON.

HXB2 Location Gag(1-20)
p17(1-20)
Gag Epitope Map
Author Location Gag
Epitope MGARASVLSGGELDRWEKIR Epitope Alignment
MGARASVLSGGELDRWEKIR epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53242

Download this epitope record as JSON.

HXB2 Location Gag(5-13)
p17(5-13)
DNA(802..828)
Gag Epitope Map
Author Location Gag(5-13 SUMA)
Epitope ASVLSGGEL Epitope Alignment
ASVLSGGEL epitope logo
Epitope Name Gag AL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62999

Download this epitope record as JSON.

HXB2 Location Gag(11-30)
p17(11-30)
Gag Epitope Map
Author Location Gag
Epitope GELDRWEKIRLRPGGKKKYK Epitope Alignment
GELDRWEKIRLRPGGKKKYK epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06; MM25: A*03, A*11, B*07, B*07, C*07, C*07; MM51: A*02, A*30, B*13, B*44, C*05, C*06; MM55: A*01, A*33, B*14, B*15, C*07, C*08
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, assay or method development

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63004

Download this epitope record as JSON.

HXB2 Location Gag(17-34)
p17(17-34)
Gag Epitope Map
Author Location Gag
Epitope EKIRLRPGGKKKYKLKHI Epitope Alignment
EKIRLRPGGKKKYKLKHI epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01; MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 57552

Download this epitope record as JSON.

HXB2 Location Gag(20-28)
p17(20-28)
DNA(847..873)
Gag Epitope Map
Author Location  
Epitope RLRPGGKKK Epitope Alignment
RLRPGGKKK epitope logo
Subtype B
Species (MHC/HLA) human(A*03)
Immunogen HIV-1 infection
Patient MHC/HLA MM25: A*03, A*11, B*07, B*07, C*07, C*07; MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods Tetramer binding
Keywords dynamics, acute/early infection, assay or method development

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63000

Download this epitope record as JSON.

HXB2 Location Gag(21-40)
p17(21-40)
Gag Epitope Map
Author Location Gag
Epitope LRPGGKKKYKLKHIVWASRE Epitope Alignment
LRPGGKKKYKLKHIVWASRE epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM40: A*24, A*24, B*07, B*27, C*05, C*07; MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62992

Download this epitope record as JSON.

HXB2 Location Gag(31-50)
p17(31-50)
Gag Epitope Map
Author Location Gag
Epitope LKHIVWASRELERFAVNPGL Epitope Alignment
LKHIVWASRELERFAVNPGL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM46: A*02, A*11, B*08, B*52, C*07, C*12
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62987

Download this epitope record as JSON.

HXB2 Location Gag(33-50)
p17(33-50)
Gag Epitope Map
Author Location Gag
Epitope HIVWASRELERFAVNPGL Epitope Alignment
HIVWASRELERFAVNPGL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62990

Download this epitope record as JSON.

HXB2 Location Gag(61-80)
p17(61-80)
Gag Epitope Map
Author Location Gag
Epitope LGQLQPSLQTGSEELRSLYN Epitope Alignment
LGQLQPSLQTGSEELRSLYN epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62986

Download this epitope record as JSON.

HXB2 Location Gag(71-90)
p17(71-90)
Gag Epitope Map
Author Location Gag
Epitope GSEELRSLYNTVATLYCVHQ Epitope Alignment
GSEELRSLYNTVATLYCVHQ epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62997

Download this epitope record as JSON.

HXB2 Location Gag(81-100)
p17(81-100)
Gag Epitope Map
Author Location Gag
Epitope TVATLYCVHQRIEVKDTKEA Epitope Alignment
TVATLYCVHQRIEVKDTKEA epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06; MM51: A*02, A*30, B*13, B*44, C*05, C*06; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53243

Download this epitope record as JSON.

HXB2 Location Gag(84-92)
p17(84-92)
DNA(1039..1065)
Gag Epitope Map
Author Location Gag(83-91 SUMA)
Epitope TLYCVHQKI Epitope Alignment
TLYCVHQKI epitope logo
Epitope Name Gag TI9
Subtype B
Species (MHC/HLA) human(A*11:03)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53230

Download this epitope record as JSON.

HXB2 Location Gag(93-101)
p17(93-101)
DNA(1066..1092)
Gag Epitope Map
Author Location Gag(99-107 WEAU)
Epitope EVKDTKEAL Epitope Alignment
EVKDTKEAL epitope logo
Epitope Name Gag EVL9
Subtype B
Species (MHC/HLA) human(B*08:01)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63007

Download this epitope record as JSON.

HXB2 Location Gag(113-130)
p17(113-130)
Gag Epitope Map
Author Location Gag
Epitope KKAQQAAADTGNSSQVSQ Epitope Alignment
KKAQQAAADTGNSSQVSQ epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM33: A*02:01, A*68:01, B*07:02, B*44:02, C*05:01, C*07:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53223

Download this epitope record as JSON.

HXB2 Location Gag(119-127)
p17(119-127)
DNA(1144..1170)
Gag Epitope Map
Author Location Gag(119-127 BORI)
Epitope AADTGNSSQ Epitope Alignment
AADTGNSSQ epitope logo
Show epitope variants
Epitope Name Gag AQ9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53224

Download this epitope record as JSON.

HXB2 Location Gag(124-133)
p17(124)-p24(1)
DNA(1159..1188)
Gag Epitope Map
Author Location Gag(124-133 BORI)
Epitope NSSQVSQNYP Epitope Alignment
NSSQVSQNYP epitope logo
Show epitope variants
Epitope Name Gag NP10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62978

Download this epitope record as JSON.

HXB2 Location Gag(138-156)
p24(6-24)
Gag Epitope Map
Author Location Gag(138-156 BORI)
Epitope LQGQMVHQALSPRTLNAWV Epitope Alignment
LQGQMVHQALSPRTLNAWV epitope logo
Show epitope variants
Epitope Name Gag 138-156
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62994

Download this epitope record as JSON.

HXB2 Location Gag(141-160)
p24(9-28)
Gag Epitope Map
Author Location Gag
Epitope QMVHQAISPRTLNAWVKVVE Epitope Alignment
QMVHQAISPRTLNAWVKVVE epitope logo
Subtype C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53231

Download this epitope record as JSON.

HXB2 Location Gag(153-162)
p24(21-30)
DNA(1246..1275)
Gag Epitope Map
Author Location Gag(153-162 WEAU)
Epitope NAWVKIEEK Epitope Alignment
NAWVKIEEK epitope logo
Epitope Name Gag NK9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63005

Download this epitope record as JSON.

HXB2 Location Gag(164-181)
p24(32-49)
Gag Epitope Map
Author Location Gag
Epitope FSPEVIPMFSALSEGATP Epitope Alignment
FSPEVIPMFSALSEGATP epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53232

Download this epitope record as JSON.

HXB2 Location Gag(175-184)
p24(43-52)
DNA(1312..1341)
Gag Epitope Map
Author Location Gag(175-184 WEAU)
Epitope LSEGATPQDL Epitope Alignment
LSEGATPQDL epitope logo
Epitope Name Gag LL10
Subtype B
Species (MHC/HLA) human(B*44:03)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62991

Download this epitope record as JSON.

HXB2 Location Gag(201-218)
p24(69-86)
Gag Epitope Map
Author Location Gag
Epitope LKETINEEAAEWDRLHPV Epitope Alignment
LKETINEEAAEWDRLHPV epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62985

Download this epitope record as JSON.

HXB2 Location Gag(211-230)
p24(79-98)
Gag Epitope Map
Author Location Gag
Epitope EWDRLHPVHAGPIAPGQMRE Epitope Alignment
EWDRLHPVHAGPIAPGQMRE epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63002

Download this epitope record as JSON.

HXB2 Location Gag(231-250)
p24(99-118)
Gag Epitope Map
Author Location Gag
Epitope PRGSDIAGTTSTLQEQIGWM Epitope Alignment
PRGSDIAGTTSTLQEQIGWM epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 57555

Download this epitope record as JSON.

HXB2 Location Gag(240-249)
p24(108-117)
DNA(1507..1536)
Gag Epitope Map
Author Location Gag
Epitope TSTLQEQIGW Epitope Alignment
TSTLQEQIGW epitope logo
Show epitope variants
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD4 T-cell Elispot - IFNγ, Other, Peptide titration
Keywords dynamics, escape, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62995

Download this epitope record as JSON.

HXB2 Location Gag(251-270)
p24(119-138)
Gag Epitope Map
Author Location Gag
Epitope TNNPPIPVGEIYKRWIILGL Epitope Alignment
TNNPPIPVGEIYKRWIILGL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM38: A*01, A*02, B*07, B*08, C*07, C*07; MM46: A*02, A*11, B*08, B*52, C*07, C*12
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 56755

Download this epitope record as JSON.

HXB2 Location Gag(259-267)
p24(127-135)
DNA(1564..1590)
Gag Epitope Map
Author Location  
Epitope GEIYKRWII Epitope Alignment
GEIYKRWII epitope logo
Subtype B
Species (MHC/HLA) human(B*08)
Immunogen HIV-1 infection
Patient MHC/HLA MM13: A*01, A*01, B*08, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Tetramer binding
Keywords dynamics, acute/early infection, optimal epitope

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53244

Download this epitope record as JSON.

HXB2 Location Gag(260-268)
p24(128-136)
DNA(1567..1593)
Gag Epitope Map
Author Location Gag(260-268 SUMA)
Epitope EIYKRWIIL Epitope Alignment
EIYKRWIIL epitope logo
Epitope Name Gag EIL9
Subtype B
Species (MHC/HLA) human(A*24:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63001

Download this epitope record as JSON.

HXB2 Location Gag(261-280)
p24(129-148)
Gag Epitope Map
Author Location Gag
Epitope IYKRWIILGLNKIVRMYSPT Epitope Alignment
IYKRWIILGLNKIVRMYSPT epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07; MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 57558

Download this epitope record as JSON.

HXB2 Location Gag(263-272)
p24(131-140)
DNA(9196..9228)
Gag Epitope Map
Author Location  
Epitope KRWIILGLNK Epitope Alignment
KRWIILGLNK epitope logo
Subtype B
Species (MHC/HLA) human(B*27)
Immunogen HIV-1 infection
Patient MHC/HLA MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods Tetramer binding
Keywords dynamics, acute/early infection, assay or method development

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63008

Download this epitope record as JSON.

HXB2 Location Gag(268-285)
p24(136-153)
Gag Epitope Map
Author Location Gag
Epitope LGLNKIVRMYSPTSILDI Epitope Alignment
LGLNKIVRMYSPTSILDI epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53245

Download this epitope record as JSON.

HXB2 Location Gag(269-277)
p24(137-145)
DNA(1594..1620)
Gag Epitope Map
Author Location Gag(269-277 SUMA)
Epitope GLNKIVRMY Epitope Alignment
GLNKIVRMY epitope logo
Epitope Name Gag GY9
Subtype B
Species (MHC/HLA) human(B*15:01)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62984

Download this epitope record as JSON.

HXB2 Location Gag(291-310)
p24(159-178)
Gag Epitope Map
Author Location Gag
Epitope EPFRDYVDRFYKTLRAEQAS Epitope Alignment
EPFRDYVDRFYKTLRAEQAS epitope logo
Subtype B, C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07; MM48: A*24, A*26, B*15, B*27, C*01, C*03; MM55: A*01, A*33, B*14, B*15, C*07, C*08
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53246

Download this epitope record as JSON.

HXB2 Location Gag(295-303)
p24(163-171)
DNA(1672..1698)
Gag Epitope Map
Author Location Gag(295-303 SUMA)
Epitope DYVDRFYKT Epitope Alignment
DYVDRFYKT epitope logo
Epitope Name Gag DT9
Subtype B
Species (MHC/HLA) human(A*24:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53222

Download this epitope record as JSON.

HXB2 Location Gag(298-308)
p24(166-176)
DNA(1681..1713)
Gag Epitope Map
Author Location Gag(295-305 BORI)
Epitope DRFYKTLRAEQ Epitope Alignment
DRFYKTLRAEQ epitope logo
Epitope Name Gag DQ11
Subtype B
Species (MHC/HLA) human(B*14:02)
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62998

Download this epitope record as JSON.

HXB2 Location Gag(301-320)
p24(169-188)
Gag Epitope Map
Author Location Gag
Epitope YKTLRAEQASQEVKNWMTET Epitope Alignment
YKTLRAEQASQEVKNWMTET epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53247

Download this epitope record as JSON.

HXB2 Location Gag(305-313)
p24(173-181)
DNA(1702..1728)
Gag Epitope Map
Author Location Gag(305-313 SUMA)
Epitope RAEQASQEV Epitope Alignment
RAEQASQEV epitope logo
Epitope Name Gag RV9
Subtype B
Species (MHC/HLA) human(C*08:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53248

Download this epitope record as JSON.

HXB2 Location Gag(335-343)
p24(203-211)
DNA(1792..1818)
Gag Epitope Map
Author Location Gag(335-343 SUMA)
Epitope KALGPAATL Epitope Alignment
KALGPAATL epitope logo
Epitope Name Gag KL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62983

Download this epitope record as JSON.

HXB2 Location Gag(341-360)
p24(209-228)
Gag Epitope Map
Author Location Gag
Epitope ATLEEMMTACQGVGGPGHKA Epitope Alignment
ATLEEMMTACQGVGGPGHKA epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53249

Download this epitope record as JSON.

HXB2 Location Gag(349-359)
p24(217-227)
DNA(1834..1866)
Gag Epitope Map
Author Location Gag(349-359 SUMA)
Epitope ACQGVGGPGHK Epitope Alignment
ACQGVGGPGHK epitope logo
Epitope Name Gag AK11
Subtype B
Species (MHC/HLA) human(A*11:03)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63003

Download this epitope record as JSON.

HXB2 Location Gag(365-382)
p2p7p1p6(2-19)
Gag Epitope Map
Author Location Gag
Epitope EAMSQVTNSAAIMMQKGT Epitope Alignment
EAMSQVTNSAAIMMQKGT epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62996

Download this epitope record as JSON.

HXB2 Location Gag(371-390)
p2p7p1p6(8-27)
Gag Epitope Map
Author Location Gag
Epitope TNSATIMMQRGNFRNQRKTV Epitope Alignment
TNSATIMMQRGNFRNQRKTV epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62989

Download this epitope record as JSON.

HXB2 Location Gag(401-417)
p2p7p1p6(38-54)
Gag Epitope Map
Author Location Gag
Epitope IAKNCRAPRKKGCWKCG Epitope Alignment
IAKNCRAPRKKGCWKCG epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62980

Download this epitope record as JSON.

HXB2 Location Gag(411-440)
p2p7p1p6(48-77)
Gag Epitope Map
Author Location Gag(410-440 SUMA)
Epitope RGCWKCGKEGHQMKDCTERQANFFGKIWPS Epitope Alignment
Epitope Name Gag 410-400
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62988

Download this epitope record as JSON.

HXB2 Location Gag(421-440)
p2p7p1p6(58-77)
Gag Epitope Map
Author Location Gag
Epitope HQMKDCTERQANFLGKIWPS Epitope Alignment
HQMKDCTERQANFLGKIWPS epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06; MM51: A*02, A*30, B*13, B*44, C*05, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63010

Download this epitope record as JSON.

HXB2 Location Gag(429-446)
p2p7p1p6(66-83)
Gag Epitope Map
Author Location Gag
Epitope RQANFLGKIWPPHKGRPG Epitope Alignment
RQANFLGKIWPPHKGRPG epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63006

Download this epitope record as JSON.

HXB2 Location Gag(481-498)
p2p7p1p6(118-135)
Gag Epitope Map
Author Location Gag
Epitope KELYPLASLRSLFGNDPS Epitope Alignment
KELYPLASLRSLFGNDPS epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63009

Download this epitope record as JSON.

HXB2 Location Pol(41-58)
Gag/Pol-TF(41)-Protease(2)
Pol Epitope Map
Author Location Gag/Pol
Epitope LSEAGTDRQGTVSLSFPQ Epitope Alignment
LSEAGTDRQGTVSLSFPQ epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63040

Download this epitope record as JSON.

HXB2 Location Pol(81-98)
Protease(25-42)
Pol Epitope Map
Author Location Protease
Epitope DTGADDTVLEEMNLPGRW Epitope Alignment
DTGADDTVLEEMNLPGRW epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM33: A*02:01, A*68:01, B*07:02, B*44:02, C*05:01, C*07:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63033

Download this epitope record as JSON.

HXB2 Location Pol(147-155)
Protease(91-99)
Pol Epitope Map
Author Location ( SUMA)
Epitope TQIGCTLNF Epitope Alignment
TQIGCTLNF epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63045

Download this epitope record as JSON.

HXB2 Location Pol(153-170)
Protease(97)-RT(15)
Pol Epitope Map
Author Location RT
Epitope LNFPISPIETVPVKLKPG Epitope Alignment
LNFPISPIETVPVKLKPG epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63046

Download this epitope record as JSON.

HXB2 Location Pol(169-186)
RT(14-31)
Pol Epitope Map
Author Location RT
Epitope PGMDGPKVKQWPLTEEKI Epitope Alignment
PGMDGPKVKQWPLTEEKI epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63041

Download this epitope record as JSON.

HXB2 Location Pol(265-282)
RT(110-127)
Pol Epitope Map
Author Location RT
Epitope DVGDAYFSVPLDKDFRKY Epitope Alignment
DVGDAYFSVPLDKDFRKY epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63048

Download this epitope record as JSON.

HXB2 Location Pol(273-290)
RT(118-135)
Pol Epitope Map
Author Location RT
Epitope VPLDKEFRKYTAFTIPSI Epitope Alignment
VPLDKEFRKYTAFTIPSI epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63044

Download this epitope record as JSON.

HXB2 Location Pol(321-338)
RT(166-183)
Pol Epitope Map
Author Location RT
Epitope KILEPFRKQNPDIVIYQY Epitope Alignment
KILEPFRKQNPDIVIYQY epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63030

Download this epitope record as JSON.

HXB2 Location Pol(375-383)
RT(220-228)
Pol Epitope Map
Author Location ( SUMA)
Epitope KHQKEPPFL Epitope Alignment
KHQKEPPFL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63036

Download this epitope record as JSON.

HXB2 Location Pol(391-410)
RT(236-255)
Pol Epitope Map
Author Location RT
Epitope PDKWTVQPIVLPEKDSWTVN Epitope Alignment
PDKWTVQPIVLPEKDSWTVN epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63043

Download this epitope record as JSON.

HXB2 Location Pol(417-434)
RT(262-279)
Pol Epitope Map
Author Location RT
Epitope GKLNWASQIYAGIKVKQL Epitope Alignment
GKLNWASQIYAGIKVKQL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63031

Download this epitope record as JSON.

HXB2 Location Pol(418-426)
RT(263-271)
Pol Epitope Map
Author Location ( SUMA)
Epitope KLNWASQIY Epitope Alignment
KLNWASQIY epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63037

Download this epitope record as JSON.

HXB2 Location Pol(491-510)
RT(336-355)
Pol Epitope Map
Author Location RT
Epitope QWTYQIYQEPFKNLKTGKYA Epitope Alignment
QWTYQIYQEPFKNLKTGKYA epitope logo
Subtype C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63047

Download this epitope record as JSON.

HXB2 Location Pol(545-562)
RT(390-407)
Pol Epitope Map
Author Location RT
Epitope RLPIQKETWEAWWTEYWQ Epitope Alignment
RLPIQKETWEAWWTEYWQ epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM42: A*02:01, A*32:01, B*07:02, B*39:06, C*07:02, C*15:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63020

Download this epitope record as JSON.

HXB2 Location Pol(551-570)
RT(396-415)
Pol Epitope Map
Author Location Pol
Epitope ETWEAWWTEYWQATWIPEWE Epitope Alignment
ETWEAWWTEYWQATWIPEWE epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63034

Download this epitope record as JSON.

HXB2 Location Pol(601-620)
RT(446-465)
Pol Epitope Map
Author Location RT
Epitope ANRETKLGKAGYVTDRGRQK Epitope Alignment
ANRETKLGKAGYVTDRGRQK epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63039

Download this epitope record as JSON.

HXB2 Location Pol(621-640)
RT(466-485)
Pol Epitope Map
Author Location RT
Epitope VVSLTDTTNQKTELQAIHLA Epitope Alignment
VVSLTDTTNQKTELQAIHLA epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63042

Download this epitope record as JSON.

HXB2 Location Pol(633-650)
RT(478-495)
Pol Epitope Map
Author Location RT
Epitope ELQAIHLALQDSGLEVNV Epitope Alignment
ELQAIHLALQDSGLEVNV epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63035

Download this epitope record as JSON.

HXB2 Location Pol(661-680)
RT(506-525)
Pol Epitope Map
Author Location RT
Epitope IQAQPDKSESELVSQIIEQL Epitope Alignment
IQAQPDKSESELVSQIIEQL epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63038

Download this epitope record as JSON.

HXB2 Location Pol(691-710)
RT(536-555)
Pol Epitope Map
Author Location RT
Epitope VPAHKGIGGNEQVDKLVSAG Epitope Alignment
VPAHKGIGGNEQVDKLVSAG epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63012

Download this epitope record as JSON.

HXB2 Location Pol(721-740)
Integrase(6-25)
Pol Epitope Map
Author Location Integrase
Epitope DKAQEEHEKYHSNWRAMASD Epitope Alignment
DKAQEEHEKYHSNWRAMASD epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM51: A*02, A*30, B*13, B*44, C*05, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63019

Download this epitope record as JSON.

HXB2 Location Pol(737-754)
Integrase(22-39)
Pol Epitope Map
Author Location Integrase
Epitope MASDFNLPPIVAKEIVAS Epitope Alignment
MASDFNLPPIVAKEIVAS epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63029

Download this epitope record as JSON.

HXB2 Location Pol(775-783)
Integrase(60-68)
Pol Epitope Map
Author Location ( SUMA)
Epitope IWQLDCTHL Epitope Alignment
IWQLDCTHL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63032

Download this epitope record as JSON.

HXB2 Location Pol(781-789)
Integrase(66-74)
Pol Epitope Map
Author Location ( SUMA)
Epitope THLEGKVIL Epitope Alignment
THLEGKVIL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63025

Download this epitope record as JSON.

HXB2 Location Pol(781-800)
Integrase(66-85)
Pol Epitope Map
Author Location Integrase
Epitope THLEGKIILVAVHVASGYIE Epitope Alignment
THLEGKIILVAVHVASGYIE epitope logo
Subtype C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63011

Download this epitope record as JSON.

HXB2 Location Pol(801-820)
Integrase(86-105)
Pol Epitope Map
Author Location Integrase
Epitope AEVIPAETGQETAYFLLKLA Epitope Alignment
AEVIPAETGQETAYFLLKLA epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63014

Download this epitope record as JSON.

HXB2 Location Pol(811-830)
Integrase(96-115)
Pol Epitope Map
Author Location Integrase
Epitope ETAYFLLKLAGRWPVKTIHT Epitope Alignment
ETAYFLLKLAGRWPVKTIHT epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63015

Download this epitope record as JSON.

HXB2 Location Pol(821-840)
Integrase(106-125)
Pol Epitope Map
Author Location Integrase
Epitope GRWPVKTIHTDNGSNFTSTT Epitope Alignment
GRWPVKTIHTDNGSNFTSTT epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM51: A*02, A*30, B*13, B*44, C*05, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63026

Download this epitope record as JSON.

HXB2 Location Pol(825-842)
Integrase(110-127)
Pol Epitope Map
Author Location Integrase
Epitope VKAIHTDNGSNFTSAAVK Epitope Alignment
VKAIHTDNGSNFTSAAVK epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM33: A*02:01, A*68:01, B*07:02, B*44:02, C*05:01, C*07:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63016

Download this epitope record as JSON.

HXB2 Location Pol(851-870)
Integrase(136-155)
Pol Epitope Map
Author Location Integrase
Epitope KQEFGIPYNPQSQGVVESMN Epitope Alignment
KQEFGIPYNPQSQGVVESMN epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM25: A*03, A*11, B*07, B*07, C*07, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63021

Download this epitope record as JSON.

HXB2 Location Pol(861-880)
Integrase(146-165)
Pol Epitope Map
Author Location Integrase
Epitope QSQGVVESMNKELKKIIGQV Epitope Alignment
QSQGVVESMNKELKKIIGQV epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63022

Download this epitope record as JSON.

HXB2 Location Pol(881-900)
Integrase(166-185)
Pol Epitope Map
Author Location Integrase
Epitope RDQAEHLKTAVQMAVFIHNF Epitope Alignment
RDQAEHLKTAVQMAVFIHNF epitope logo
Subtype C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63017

Download this epitope record as JSON.

HXB2 Location Pol(901-920)
Integrase(186-205)
Pol Epitope Map
Author Location Integrase
Epitope KRKGGIGGYSAGERIVDIIA Epitope Alignment
KRKGGIGGYSAGERIVDIIA epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM40: A*24, A*24, B*07, B*27, C*05, C*07; MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63024

Download this epitope record as JSON.

HXB2 Location Pol(921-940)
Integrase(206-225)
Pol Epitope Map
Author Location Integrase
Epitope TDIQTKELQKQITKIQNFRV Epitope Alignment
TDIQTKELQKQITKIQNFRV epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63018

Download this epitope record as JSON.

HXB2 Location Pol(953-970)
Integrase(238-255)
Pol Epitope Map
Author Location Integrase
Epitope PAKLLWKGEGAVVIQDNS Epitope Alignment
PAKLLWKGEGAVVIQDNS epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63013

Download this epitope record as JSON.

HXB2 Location Pol(961-980)
Integrase(246-265)
Pol Epitope Map
Author Location Integrase
Epitope EGAVVIQDNSDIKVVPRRKA Epitope Alignment
EGAVVIQDNSDIKVVPRRKA epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM55: A*01, A*33, B*14, B*15, C*07, C*08
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63023

Download this epitope record as JSON.

HXB2 Location Pol(984-1003)
Integrase(269-288)
Pol Epitope Map
Author Location Integrase
Epitope RDYGKQMAGDDCVASRQDED Epitope Alignment
RDYGKQMAGDDCVASRQDED epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63090

Download this epitope record as JSON.

HXB2 Location Vif(11-30) Vif Epitope Map
Author Location Vif
Epitope WQVDRMRIRTWKSLVKHHMY Epitope Alignment
WQVDRMRIRTWKSLVKHHMY epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63087

Download this epitope record as JSON.

HXB2 Location Vif(31-50) Vif Epitope Map
Author Location Vif
Epitope ISRKAKGWFYRHHYESTHPR Epitope Alignment
ISRKAKGWFYRHHYESTHPR epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM28: A*11, A*30, B*13, B*35, C*04, C*06; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63088

Download this epitope record as JSON.

HXB2 Location Vif(51-70) Vif Epitope Map
Author Location Vif
Epitope ISSEVHIPLGDARLVITTYW Epitope Alignment
ISSEVHIPLGDARLVITTYW epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06; MM25: A*03, A*11, B*07, B*07, C*07, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63085

Download this epitope record as JSON.

HXB2 Location Vif(61-80) Vif Epitope Map
Author Location Vif
Epitope DARLVITTYWGLHTGERDWH Epitope Alignment
DARLVITTYWGLHTGERDWH epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63086

Download this epitope record as JSON.

HXB2 Location Vif(71-90) Vif Epitope Map
Author Location Vif
Epitope GLHTGERDWHLGQGVSIEWR Epitope Alignment
GLHTGERDWHLGQGVSIEWR epitope logo
Subtype C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63089

Download this epitope record as JSON.

HXB2 Location Vif(91-110) Vif Epitope Map
Author Location Vif
Epitope KKRYSTQVDPDLADQLIHLY Epitope Alignment
KKRYSTQVDPDLADQLIHLY epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63091

Download this epitope record as JSON.

HXB2 Location Vif(111-130) Vif Epitope Map
Author Location Vif
Epitope YFDCFSESAIRNAILGHIVS Epitope Alignment
YFDCFSESAIRNAILGHIVS epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63081

Download this epitope record as JSON.

HXB2 Location Vif(113-130) Vif Epitope Map
Author Location Vif
Epitope DCFSESAIRGAILGHIVS Epitope Alignment
DCFSESAIRGAILGHIVS epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63082

Download this epitope record as JSON.

HXB2 Location Vpr(9-26) Vpr Epitope Map
Author Location Vpr
Epitope GPQREPFNEWTLELLEEL Epitope Alignment
GPQREPFNEWTLELLEEL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63083

Download this epitope record as JSON.

HXB2 Location Vpr(73-90) Vpr Epitope Map
Author Location Vpr
Epitope RIGCQHSRIGIIQRRRAR Epitope Alignment
RIGCQHSRIGIIQRRRAR epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63084

Download this epitope record as JSON.

HXB2 Location Vpr(77-96) Vpr Epitope Map
Author Location Vpr
Epitope QHSRIGITRQRRARNGASRS Epitope Alignment
QHSRIGITRQRRARNGASRS epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53250

Download this epitope record as JSON.

HXB2 Location Tat(12-21)
DNA(5864..5893)
Tat Epitope Map
Author Location Tat(12-21 SUMA)
Epitope KHPGSQPKTA Epitope Alignment
KHPGSQPKTA epitope logo
Epitope Name Tat KA10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53233

Download this epitope record as JSON.

HXB2 Location Tat(24-32)
DNA(5900..5926)
Tat Epitope Map
Author Location Tat(24-32 WEAU)
Epitope NCYCKRCCF Epitope Alignment
NCYCKRCCF epitope logo
Show epitope variants
Epitope Name Tat NF9
Subtype B
Species (MHC/HLA) human(A*29:02)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53225

Download this epitope record as JSON.

HXB2 Location Tat(24-32)
DNA(5900..5926)
Tat Epitope Map
Author Location Tat(24-32 BORI)
Epitope NCYCKKCCY Epitope Alignment
NCYCKKCCY epitope logo
Show epitope variants
Epitope Name Tat NY9
Subtype B
Species (MHC/HLA) human(A*29:02)
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63078

Download this epitope record as JSON.

HXB2 Location Tat(31-50) Tat Epitope Map
Author Location Tat
Epitope CFHCQVCFITKGLGISYGRK Epitope Alignment
CFHCQVCFITKGLGISYGRK epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, escape, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53235

Download this epitope record as JSON.

HXB2 Location Tat(32-41)
DNA(5924..5953)
Tat Epitope Map
Author Location Tat(32-41 SUMA)
Epitope FHCQVCFMTK Epitope Alignment
FHCQVCFMTK epitope logo
Show epitope variants
Epitope Name Tat FK10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, epitope processing, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63080

Download this epitope record as JSON.

HXB2 Location Tat(33-50) Tat Epitope Map
Author Location Tat
Epitope HCQVCFISKGLGISYGRK Epitope Alignment
HCQVCFISKGLGISYGRK epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53236

Download this epitope record as JSON.

HXB2 Location Tat(36-45)
DNA(5936..5965)
Tat Epitope Map
Author Location Tat(36-45 SUMA)
Epitope VCFMTKGLGI Epitope Alignment
VCFMTKGLGI epitope logo
Show epitope variants
Epitope Name Tat VI10
Subtype B
Species (MHC/HLA) human(B*15:01)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, epitope processing, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53237

Download this epitope record as JSON.

HXB2 Location Tat(39-47)
DNA(5945..5971)
Tat Epitope Map
Author Location Tat(39-47 SUMA)
Epitope MTKGLGISY Epitope Alignment
MTKGLGISY epitope logo
Show epitope variants
Epitope Name Tat MY9
Subtype B
Species (MHC/HLA) human(B*15:01)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, epitope processing, immunodominance, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63074

Download this epitope record as JSON.

HXB2 Location Rev(1-20) Rev Epitope Map
Author Location Rev
Epitope MAGRSGDSDEELLKTVRLIK Epitope Alignment
MAGRSGDSDEELLKTVRLIK epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06; MM46: A*02, A*11, B*08, B*52, C*07, C*12
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63073

Download this epitope record as JSON.

HXB2 Location Rev(21-40) Rev Epitope Map
Author Location Rev
Epitope FLYQSNPPPSPEGTRQARRN Epitope Alignment
FLYQSNPPPSPEGTRQARRN epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM25: A*03, A*11, B*07, B*07, C*07, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63075

Download this epitope record as JSON.

HXB2 Location Rev(31-50) Rev Epitope Map
Author Location Rev
Epitope PEGTRQARRNRRRRWRERQR Epitope Alignment
PEGTRQARRNRRRRWRERQR epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM46: A*02, A*11, B*08, B*52, C*07, C*12; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63076

Download this epitope record as JSON.

HXB2 Location Rev(51-70) Rev Epitope Map
Author Location Rev
Epitope QIRSISEWILSTYLGRPAEP Epitope Alignment
QIRSISEWILSTYLGRPAEP epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM55: A*01, A*33, B*14, B*15, C*07, C*08; MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63079

Download this epitope record as JSON.

HXB2 Location Rev(65-82) Rev Epitope Map
Author Location Rev
Epitope GRPAEPVPLQLPPLERLT Epitope Alignment
GRPAEPVPLQLPPLERLT epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 57556

Download this epitope record as JSON.

HXB2 Location Rev(66-75)
DNA(8498..8527)
Rev Epitope Map
Author Location  
Epitope RPAELVLQL Epitope Alignment
RPAELVLQL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD4 T-cell Elispot - IFNγ, Other, Peptide titration
Keywords dynamics, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63077

Download this epitope record as JSON.

HXB2 Location Rev(97-116) Rev Epitope Map
Author Location Rev
Epitope VGSPQILVESPAVLESGTKE Epitope Alignment
VGSPQILVESPAVLESGTKE epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM46: A*02, A*11, B*08, B*52, C*07, C*12
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62955

Download this epitope record as JSON.

HXB2 Location gp160(1-19)
gp120(1-19)
gp160 Epitope Map
Author Location Env
Epitope MKVKGIRKNWHNLGKWGS Epitope Alignment
MKVKGIRKNWHNLGKWGS epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM42: A*02:01, A*32:01, B*07:02, B*39:06, C*07:02, C*15:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62981

Download this epitope record as JSON.

HXB2 Location gp160(6-20)
gp120(6-20)
gp160 Epitope Map
Author Location Env
Epitope NYQHLWRGGIMLLWRGIM Epitope Alignment
NYQHLWRGGIMLLWRGIM epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53226

Download this epitope record as JSON.

HXB2 Location gp160(31-39)
gp120(31-39)
DNA(6315..6341)
gp160 Epitope Map
Author Location gp160(30-38 WEAU)
Epitope AENLWVTVY Epitope Alignment
AENLWVTVY epitope logo
Show epitope variants
Epitope Name gp160 AY9
Subtype B
Species (MHC/HLA) human(B*44:03)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53238

Download this epitope record as JSON.

HXB2 Location gp160(32-40)
gp120(32-40)
DNA(6318..6344)
gp160 Epitope Map
Author Location gp160(29-37 SUMA)
Epitope ENLWVTVYY Epitope Alignment
ENLWVTVYY epitope logo
Epitope Name gp160 EY9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62948

Download this epitope record as JSON.

HXB2 Location gp160(32-51)
gp120(32-51)
gp160 Epitope Map
Author Location Env
Epitope EQLWVTVYYGVPVWKEATTT Epitope Alignment
EQLWVTVYYGVPVWKEATTT epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM38: A*01, A*02, B*07, B*08, C*07, C*07; MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62957

Download this epitope record as JSON.

HXB2 Location gp160(92-111)
gp120(92-111)
gp160 Epitope Map
Author Location Env
Epitope NFNMWKNNMVEQMHEDIISL Epitope Alignment
NFNMWKNNMVEQMHEDIISL epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM25: A*03, A*11, B*07, B*07, C*07, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62949

Download this epitope record as JSON.

HXB2 Location gp160(102-121)
gp120(102-121)
gp160 Epitope Map
Author Location Env
Epitope EQMHEDIISLWDQSLKPCVK Epitope Alignment
EQMHEDIISLWDQSLKPCVK epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62966

Download this epitope record as JSON.

HXB2 Location gp160(132-152)
gp120(132-152)
gp160 Epitope Map
Author Location Env
Epitope TDLNNNTNTTSSSGEKMEKG Epitope Alignment
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM25: A*03, A*11, B*07, B*07, C*07, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62972

Download this epitope record as JSON.

HXB2 Location gp160(164-183)
gp120(164-183)
gp160 Epitope Map
Author Location gp160(160-180 SUMA)
Epitope NMRDKKQKEYALFYNLDIVQ Epitope Alignment
NMRDKKQKEYALFYNLDIVQ epitope logo
Epitope Name gp160 160-180
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53219

Download this epitope record as JSON.

HXB2 Location gp160(209-217)
gp120(209-217)
DNA(6849..6875)
gp160 Epitope Map
Author Location gp160(207-215 BORI, WEAU)
Epitope SFEPIPIHY Epitope Alignment
SFEPIPIHY epitope logo
Show epitope variants
Epitope Name gp160 SY9
Subtype B
Species (MHC/HLA) human(A*29:02)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44; BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63072

Download this epitope record as JSON.

HXB2 Location gp160(213-230)
gp120(213-230)
gp160 Epitope Map
Author Location Env
Epitope IPIHYCAPAGFAILKCNN Epitope Alignment
IPIHYCAPAGFAILKCNN epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62952

Download this epitope record as JSON.

HXB2 Location gp160(213-232)
gp120(213-232)
gp160 Epitope Map
Author Location Env
Epitope IPIHYCAPAGFAILKCNDKK Epitope Alignment
IPIHYCAPAGFAILKCNDKK epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53220

Download this epitope record as JSON.

HXB2 Location gp160(239-247)
gp120(239-247)
DNA(6939..6965)
gp160 Epitope Map
Author Location gp160(237-245 BORI)
Epitope CKNVSTVQC Epitope Alignment
CKNVSTVQC epitope logo
Show epitope variants
Epitope Name gp160 CC9
Subtype B
Species (MHC/HLA) human(C*08:02)
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62967

Download this epitope record as JSON.

HXB2 Location gp160(303-324)
gp120(303-324)
gp160 Epitope Map
Author Location Env
Epitope TRKSIHIGPGRAFYTTGEII Epitope Alignment
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53227

Download this epitope record as JSON.

HXB2 Location gp160(310-318)
gp120(310-318)
DNA(7152..7178)
gp160 Epitope Map
Author Location gp160(313-321 WEAU)
Epitope TLGPGRVLY Epitope Alignment
TLGPGRVLY epitope logo
Epitope Name gp160 TY9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62946

Download this epitope record as JSON.

HXB2 Location gp160(318-335)
gp120(318-335)
gp160 Epitope Map
Author Location Env
Epitope ATGDIIGDIRKAYCNING Epitope Alignment
ATGDIIGDIRKAYCNING epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM42: A*02:01, A*32:01, B*07:02, B*39:06, C*07:02, C*15:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53239

Download this epitope record as JSON.

HXB2 Location gp160(377-386)
gp120(377-386)
DNA(7353..7382)
gp160 Epitope Map
Author Location gp160(374-383 SUMA)
Epitope NCGGEFFYCN Epitope Alignment
NCGGEFFYCN epitope logo
Epitope Name gp160 NN10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53240

Download this epitope record as JSON.

HXB2 Location gp160(383-391)
gp120(383-391)
DNA(7371..7397)
gp160 Epitope Map
Author Location gp160(380-389 SUMA)
Epitope FYCNTTQLF Epitope Alignment
FYCNTTQLF epitope logo
Epitope Name gp160 FF9
Subtype B
Species (MHC/HLA) human(A*24:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62975

Download this epitope record as JSON.

HXB2 Location gp160(393-402)
gp120(393-402)
gp160 Epitope Map
Author Location gp160(390-401 SUMA)
Epitope STWYINNTGNGA Epitope Alignment
STWYINNTGNGA epitope logo
Epitope Name gp160 390-401
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62974

Download this epitope record as JSON.

HXB2 Location gp160(403-417)
gp120(403-417)
gp160 Epitope Map
Author Location gp160(410-425 SUMA)
Epitope KGSDNTDTIKLP Epitope Alignment
KGSDNTDTIKLP epitope logo
Epitope Name gp160 410-425
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62959

Download this epitope record as JSON.

HXB2 Location gp160(410-429)
gp120(410-429)
gp160 Epitope Map
Author Location Env
Epitope NTDTITLPCRIKQIINMWQE Epitope Alignment
NTDTITLPCRIKQIINMWQE epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62973

Download this epitope record as JSON.

HXB2 Location gp160(414-429)
gp120(414-429)
gp160 Epitope Map
Author Location gp160(410-425 SUMA)
Epitope IKLPCRIKQIINMWQE Epitope Alignment
IKLPCRIKQIINMWQE epitope logo
Epitope Name gp160 410-425
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62976

Download this epitope record as JSON.

HXB2 Location gp160(430-445)
gp120(430-445)
gp160 Epitope Map
Author Location gp160(390-401 SUMA)
Epitope VGKAMYAPPIRGQIRC Epitope Alignment
VGKAMYAPPIRGQIRC epitope logo
Epitope Name gp160 390-401
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62982

Download this epitope record as JSON.

HXB2 Location gp160(430-449)
gp120(430-449)
gp160 Epitope Map
Author Location Env
Epitope VGKAMYAPPIRGQIRCSSNI Epitope Alignment
VGKAMYAPPIRGQIRCSSNI epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62964

Download this epitope record as JSON.

HXB2 Location gp160(440-459)
gp120(440-459)
gp160 Epitope Map
Author Location Env
Epitope RGQIRCSSNITGLLLTRDGG Epitope Alignment
RGQIRCSSNITGLLLTRDGG epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62971

Download this epitope record as JSON.

HXB2 Location gp160(443-452)
gp120(443-452)
gp160 Epitope Map
Author Location gp160(439-448 SUMA)
Epitope IRCSSNITGL Epitope Alignment
IRCSSNITGL epitope logo
Epitope Name gp160 IL10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62965

Download this epitope record as JSON.

HXB2 Location gp160(480-499)
gp120(480-499)
gp160 Epitope Map
Author Location Env
Epitope RSELYKYKVVKIEPLGVAPT Epitope Alignment
RSELYKYKVVKIEPLGVAPT epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53241

Download this epitope record as JSON.

HXB2 Location gp160(486-494)
gp120(486-494)
DNA(7680..7706)
gp160 Epitope Map
Author Location gp160(485-493 SUMA)
Epitope YKVVKIEPL Epitope Alignment
YKVVKIEPL epitope logo
Epitope Name gp160 YL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62954

Download this epitope record as JSON.

HXB2 Location gp160(530-549)
gp41(19-38)
gp160 Epitope Map
Author Location Env
Epitope MGAASMTLTVQARQLLSGIV Epitope Alignment
MGAASMTLTVQARQLLSGIV epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62961

Download this epitope record as JSON.

HXB2 Location gp160(540-558)
gp41(29-47)
gp160 Epitope Map
Author Location Env
Epitope QARQLLSGIVQQQNNLLRA Epitope Alignment
QARQLLSGIVQQQNNLLRA epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62963

Download this epitope record as JSON.

HXB2 Location gp160(550-569)
gp41(39-58)
gp160 Epitope Map
Author Location Env
Epitope QQQNNLLRAIEAQQHLLQLT Epitope Alignment
QQQNNLLRAIEAQQHLLQLT epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62968

Download this epitope record as JSON.

HXB2 Location gp160(580-599)
gp41(69-88)
gp160 Epitope Map
Author Location Env
Epitope VLAVERYLKDQQLLGIWGCS Epitope Alignment
VLAVERYLKDQQLLGIWGCS epitope logo
Subtype B, C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07; MM55: A*01, A*33, B*14, B*15, C*07, C*08
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53221

Download this epitope record as JSON.

HXB2 Location gp160(584-592)
gp41(73-81)
DNA(7974..8000)
gp160 Epitope Map
Author Location gp160(598-597 BORI, SUMA)
Epitope ERYLKDQQL Epitope Alignment
ERYLKDQQL epitope logo
Show epitope variants
Epitope Name gp160 EL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA A*11:03, A*24:02, B*14:02, B*15:01, C*08:02; BORI: A02, A29, B14, B44; SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62970

Download this epitope record as JSON.

HXB2 Location gp160(701-718)
gp41(190-207)
gp160 Epitope Map
Author Location Env
Epitope VLSIVNRVRQGYSPLSLQ Epitope Alignment
VLSIVNRVRQGYSPLSLQ epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM42: A*02:01, A*32:01, B*07:02, B*39:06, C*07:02, C*15:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62962

Download this epitope record as JSON.

HXB2 Location gp160(710-729)
gp41(199-218)
gp160 Epitope Map
Author Location Env
Epitope QGYSPLSFQTRLPAPRGPDR Epitope Alignment
QGYSPLSFQTRLPAPRGPDR epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM56: A*02, A*24, B*35, B*57, C*04, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62960

Download this epitope record as JSON.

HXB2 Location gp160(730-749)
gp41(219-238)
gp160 Epitope Map
Author Location Env
Epitope PEGIEEEGGERDRDRSGRLV Epitope Alignment
PEGIEEEGGERDRDRSGRLV epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Other
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62953

Download this epitope record as JSON.

HXB2 Location gp160(765-782)
gp41(254-271)
gp160 Epitope Map
Author Location Env
Epitope LFSYHRLRDLLLIVARIV Epitope Alignment
LFSYHRLRDLLLIVARIV epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM42: A*02:01, A*32:01, B*07:02, B*39:06, C*07:02, C*15:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62958

Download this epitope record as JSON.

HXB2 Location gp160(798-815)
gp41(287-304)
gp160 Epitope Map
Author Location Env
Epitope NLLQYWSQELKNSAVSLL Epitope Alignment
NLLQYWSQELKNSAVSLL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62950

Download this epitope record as JSON.

HXB2 Location gp160(820-839)
gp41(309-328)
gp160 Epitope Map
Author Location Env
Epitope IAVAEGTDRVIEVVQRACRA Epitope Alignment
IAVAEGTDRVIEVVQRACRA epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53228

Download this epitope record as JSON.

HXB2 Location gp160(824-832)
gp41(313-321)
DNA(8694..8720)
gp160 Epitope Map
Author Location gp160(828-836 WEAU)
Epitope EGTDRIVIEI Epitope Alignment
EGTDRIVIEI epitope logo
Epitope Name gp160 EI9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62951

Download this epitope record as JSON.

HXB2 Location gp160(830-849)
gp41(319-338)
gp160 Epitope Map
Author Location Env
Epitope IEVVQRACRAILHIPRRIRQ Epitope Alignment
IEVVQRACRAILHIPRRIRQ epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM49: A*02, A*02, B*35, B*51, C*04, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53229

Download this epitope record as JSON.

HXB2 Location gp160(833-841)
gp41(322-330)
DNA(8721..8747)
gp160 Epitope Map
Author Location gp160(837-845 WEAU)
Epitope VQRTCRAIL Epitope Alignment
VQRTCRAIL epitope logo
Epitope Name gp160 VL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62947

Download this epitope record as JSON.

HXB2 Location gp160(837-856)
gp41(326-345)
gp160 Epitope Map
Author Location Env
Epitope CRAILHIPRRIRQGLERALL Epitope Alignment
CRAILHIPRRIRQGLERALL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06; MM46: A*02, A*11, B*08, B*52, C*07, C*12; MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63071

Download this epitope record as JSON.

HXB2 Location gp160(838-855)
gp41(327-344)
gp160 Epitope Map
Author Location Env
Epitope RAILHIPTRIRQGLERCL Epitope Alignment
RAILHIPTRIRQGLERCL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM33: A*02:01, A*68:01, B*07:02, B*44:02, C*05:01, C*07:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63070

Download this epitope record as JSON.

HXB2 Location gp160(838-855)
gp41(327-344)
gp160 Epitope Map
Author Location Env
Epitope RAILHIPRRIRQGLERSL Epitope Alignment
RAILHIPRRIRQGLERSL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM45: A*03, A*31, B*07, B*51, C*07, C*15
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63063

Download this epitope record as JSON.

HXB2 Location Nef(1-20) Nef Epitope Map
Author Location Nef
Epitope MGGKWSKRSVVGWPTVRERM Epitope Alignment
MGGKWSKRSVVGWPTVRERM epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63055

Download this epitope record as JSON.

HXB2 Location Nef(41-58) Nef Epitope Map
Author Location Nef
Epitope GALTSSNTPSNNATCAWL Epitope Alignment
GALTSSNTPSNNATCAWL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63058

Download this epitope record as JSON.

HXB2 Location Nef(41-60) Nef Epitope Map
Author Location Nef
Epitope GAITSSNTAANNADCAWLEA Epitope Alignment
GAITSSNTAANNADCAWLEA epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM55: A*01, A*33, B*14, B*15, C*07, C*08
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63065

Download this epitope record as JSON.

HXB2 Location Nef(61-80) Nef Epitope Map
Author Location Nef
Epitope QEEEEVGFPVRPQVPLRPMT Epitope Alignment
QEEEEVGFPVRPQVPLRPMT epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM46: A*02, A*11, B*08, B*52, C*07, C*12
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63051

Download this epitope record as JSON.

HXB2 Location Nef(65-82) Nef Epitope Map
Author Location Nef
Epitope EVGFPVRPQVPLRPMTYK Epitope Alignment
EVGFPVRPQVPLRPMTYK epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01; MM33: A*02:01, A*68:01, B*07:02, B*44:02, C*05:01, C*07:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63066

Download this epitope record as JSON.

HXB2 Location Nef(71-90) Nef Epitope Map
Author Location Nef
Epitope RPQVPLRPMTYKAAVDLSHF Epitope Alignment
RPQVPLRPMTYKAAVDLSHF epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06; MM25: A*03, A*11, B*07, B*07, C*07, C*07; MM55: A*01, A*33, B*14, B*15, C*07, C*08
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 56756

Download this epitope record as JSON.

HXB2 Location Nef(73-82)
DNA(9013..9042)
Nef Epitope Map
Author Location  
Epitope QVPLRPMTYK Epitope Alignment
QVPLRPMTYK epitope logo
Subtype B
Species (MHC/HLA) human(A*03)
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01; MM12: A*03, A*68, B*07, B*44, C*07, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ, Tetramer binding
Keywords acute/early infection, optimal epitope

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 57550

Download this epitope record as JSON.

HXB2 Location Nef(74-81)
DNA(9016..9039)
Nef Epitope Map
Author Location  
Epitope VPLRPMTY Epitope Alignment
VPLRPMTY epitope logo
Subtype B
Species (MHC/HLA) human(A*11)
Immunogen HIV-1 infection
Patient MHC/HLA MM28: A*11, A*30, B*13, B*35, C*04, C*06
Country United Kingdom
Experimental methods Tetramer binding
Keywords dynamics, acute/early infection, assay or method development

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63056

Download this epitope record as JSON.

HXB2 Location Nef(81-98) Nef Epitope Map
Author Location Nef
Epitope YKGAVDLSHFLKEKGGLE Epitope Alignment
YKGAVDLSHFLKEKGGLE epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM33: A*02:01, A*68:01, B*07:02, B*44:02, C*05:01, C*07:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63069

Download this epitope record as JSON.

HXB2 Location Nef(81-100) Nef Epitope Map
Author Location Nef
Epitope YKAAVDLSHFLKEKGGLEGL Epitope Alignment
YKAAVDLSHFLKEKGGLEGL epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM46: A*02, A*11, B*08, B*52, C*07, C*12
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63053

Download this epitope record as JSON.

HXB2 Location Nef(89-106) Nef Epitope Map
Author Location Nef
Epitope FFLKEKGGLEGLIHSQKR Epitope Alignment
FFLKEKGGLEGLIHSQKR epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 56757

Download this epitope record as JSON.

HXB2 Location Nef(90-97)
DNA(9064..9087)
Nef Epitope Map
Author Location  
Epitope FLKEKGGL Epitope Alignment
FLKEKGGL epitope logo
Subtype B
Species (MHC/HLA) human(B*08)
Immunogen HIV-1 infection
Patient MHC/HLA MM13: A*01, A*01, B*08, B*57, C*06, C*07
Country United Kingdom
Experimental methods Tetramer binding
Keywords acute/early infection, optimal epitope

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63061

Download this epitope record as JSON.

HXB2 Location Nef(91-110) Nef Epitope Map
Author Location Nef
Epitope LKEKGGLEGLIYSQKRQDIL Epitope Alignment
LKEKGGLEGLIYSQKRQDIL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 57559

Download this epitope record as JSON.

HXB2 Location Nef(92-100)
DNA(9070..9096)
Nef Epitope Map
Author Location  
Epitope KEKGGLEGL Epitope Alignment
KEKGGLEGL epitope logo
Subtype B
Species (MHC/HLA) human(B*40)
Immunogen HIV-1 infection
Patient MHC/HLA MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods Tetramer binding
Keywords dynamics, acute/early infection, assay or method development

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63060

Download this epitope record as JSON.

HXB2 Location Nef(101-120) Nef Epitope Map
Author Location Nef
Epitope IYSQKRQDILDLWVYHTQGY Epitope Alignment
IYSQKRQDILDLWVYHTQGY epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM25: A*03, A*11, B*07, B*07, C*07, C*07; MM51: A*02, A*30, B*13, B*44, C*05, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63057

Download this epitope record as JSON.

HXB2 Location Nef(111-130) Nef Epitope Map
Author Location Nef
Epitope DLWVYHTQGYFPDWQNYTPG Epitope Alignment
DLWVYHTQGYFPDWQNYTPG epitope logo
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM19: A*01, A*68, B*44, B*57, C*06, C*07
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63054

Download this epitope record as JSON.

HXB2 Location Nef(121-138) Nef Epitope Map
Author Location Nef
Epitope FPDWQNYTPGPGIRYPLT Epitope Alignment
FPDWQNYTPGPGIRYPLT epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM39: A*02:01, A*03:01, B*15:01, B*35:01, C*03:03:01, C*04:01:01:01
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63064

Download this epitope record as JSON.

HXB2 Location Nef(131-150) Nef Epitope Map
Author Location Nef
Epitope PGIRYPLTFGWCFKLVPVEP Epitope Alignment
PGIRYPLTFGWCFKLVPVEP epitope logo
Subtype B, C
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM23: A*02, A*23, B*44, B*49, C*05, C*07; MM40: A*24, A*24, B*07, B*27, C*05, C*07; MM47: A*24, A*24, B*14, B*39, C*02, C*07; MM48: A*24, A*26, B*15, B*27, C*01, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 57557

Download this epitope record as JSON.

HXB2 Location Nef(134-143)
DNA(9196..9225)
Nef Epitope Map
Author Location  
Epitope RYPLTFGWCF Epitope Alignment
RYPLTFGWCF epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human(A*24)
Immunogen HIV-1 infection
Patient MHC/HLA MM40: A*24, A*24, B*07, B*27, C*05, C*07
Country United Kingdom
Experimental methods Tetramer binding
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63067

Download this epitope record as JSON.

HXB2 Location Nef(134-143) Nef Epitope Map
Author Location Nef
Epitope RYPLTFGWCY Epitope Alignment
RYPLTFGWCY epitope logo
Show epitope variants
Subtype C
Species (MHC/HLA) human(A*24)
Immunogen HIV-1 infection
Patient MHC/HLA MM47: A*24, A*24, B*14, B*39, C*02, C*07
Country United Kingdom
Experimental methods Tetramer binding
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63059

Download this epitope record as JSON.

HXB2 Location Nef(171-190) Nef Epitope Map
Author Location Nef
Epitope HGMDDPEREVLVWKFDSRLA Epitope Alignment
HGMDDPEREVLVWKFDSRLA epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM46: A*02, A*11, B*08, B*52, C*07, C*12; MM50: A*02, A*03, B*13, B*40, C*03, C*06
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63050

Download this epitope record as JSON.

HXB2 Location Nef(177-194) Nef Epitope Map
Author Location Nef
Epitope EKEVLEWRFDITLAHHHR Epitope Alignment
EKEVLEWRFDITLAHHHR epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM43: A*02, A*02:01, B*40:01, B*55:01, C*03, C*03
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63049

Download this epitope record as JSON.

HXB2 Location Nef(177-194) Nef Epitope Map
Author Location Nef
Epitope EGEVLQWKFDSRLAFHHM Epitope Alignment
EGEVLQWKFDSRLAFHHM epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM33: A*02:01, A*68:01, B*07:02, B*44:02, C*05:01, C*07:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63062

Download this epitope record as JSON.

HXB2 Location Nef(181-200) Nef Epitope Map
Author Location Nef
Epitope LVWKFDSRLAFHHMARELHP Epitope Alignment
LVWKFDSRLAFHHMARELHP epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM55: A*01, A*33, B*14, B*15, C*07, C*08
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63052

Download this epitope record as JSON.

HXB2 Location Nef(185-202) Nef Epitope Map
Author Location Nef
Epitope FDSRLAFHHIARELHPEY Epitope Alignment
FDSRLAFHHIARELHPEY epitope logo
Show epitope variants
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM42: A*02:01, A*32:01, B*07:02, B*39:06, C*07:02, C*15:02
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, immunodominance, acute/early infection, autologous responses

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63068

Download this epitope record as JSON.

HXB2 Location Nef(187-206) Nef Epitope Map
Author Location Nef
Epitope SRLAFHHMARELHPEYYKDC Epitope Alignment
SRLAFHHMARELHPEYYKDC epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA MM46: A*02, A*11, B*08, B*52, C*07, C*12
Country United Kingdom
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection

Notes

References

Turnbull2009 Emma L. Turnbull, MaiLee Wong, Shuyi Wang, Xiping Wei, Nicola A. Jones, Karen E. Conrod, Diana Aldam, Jo Turner, Pierre Pellegrino, Brandon F. Keele, Ian Williams, George M. Shaw, and Persephone Borrow. Kinetics of Expansion of Epitope-Specific T Cell Responses During primary HIV-1 Infection. J. Immunol., 182(11):7131-7145, 1 Jun 2009. PubMed ID: 19454710. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030