HIV molecular immunology database

 

Search CTL/CD8+ T-Cell Epitope Database

Found 45 matching records:

Displaying record number 53242

Download this epitope record as JSON.

HXB2 Location Gag(5-13)
p17(5-13)
DNA(802..828)
Gag Epitope Map
Author Location Gag(5-13 SUMA)
Epitope ASVLSGGEL Epitope Alignment
ASVLSGGEL epitope logo
Epitope Name Gag AL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53243

Download this epitope record as JSON.

HXB2 Location Gag(84-92)
p17(84-92)
DNA(1039..1065)
Gag Epitope Map
Author Location Gag(83-91 SUMA)
Epitope TLYCVHQKI Epitope Alignment
TLYCVHQKI epitope logo
Epitope Name Gag TI9
Subtype B
Species (MHC/HLA) human(A*11:03)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53230

Download this epitope record as JSON.

HXB2 Location Gag(93-101)
p17(93-101)
DNA(1066..1092)
Gag Epitope Map
Author Location Gag(99-107 WEAU)
Epitope EVKDTKEAL Epitope Alignment
EVKDTKEAL epitope logo
Epitope Name Gag EVL9
Subtype B
Species (MHC/HLA) human(B*08:01)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53223

Download this epitope record as JSON.

HXB2 Location Gag(119-127)
p17(119-127)
DNA(1144..1170)
Gag Epitope Map
Author Location Gag(119-127 BORI)
Epitope AADTGNSSQ Epitope Alignment
AADTGNSSQ epitope logo
Show epitope variants
Epitope Name Gag AQ9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53224

Download this epitope record as JSON.

HXB2 Location Gag(124-133)
p17(124)-p24(1)
DNA(1159..1188)
Gag Epitope Map
Author Location Gag(124-133 BORI)
Epitope NSSQVSQNYP Epitope Alignment
NSSQVSQNYP epitope logo
Show epitope variants
Epitope Name Gag NP10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62978

Download this epitope record as JSON.

HXB2 Location Gag(138-156)
p24(6-24)
Gag Epitope Map
Author Location Gag(138-156 BORI)
Epitope LQGQMVHQALSPRTLNAWV Epitope Alignment
LQGQMVHQALSPRTLNAWV epitope logo
Show epitope variants
Epitope Name Gag 138-156
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53231

Download this epitope record as JSON.

HXB2 Location Gag(153-162)
p24(21-30)
DNA(1246..1275)
Gag Epitope Map
Author Location Gag(153-162 WEAU)
Epitope NAWVKIEEK Epitope Alignment
NAWVKIEEK epitope logo
Epitope Name Gag NK9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53232

Download this epitope record as JSON.

HXB2 Location Gag(175-184)
p24(43-52)
DNA(1312..1341)
Gag Epitope Map
Author Location Gag(175-184 WEAU)
Epitope LSEGATPQDL Epitope Alignment
LSEGATPQDL epitope logo
Epitope Name Gag LL10
Subtype B
Species (MHC/HLA) human(B*44:03)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53244

Download this epitope record as JSON.

HXB2 Location Gag(260-268)
p24(128-136)
DNA(1567..1593)
Gag Epitope Map
Author Location Gag(260-268 SUMA)
Epitope EIYKRWIIL Epitope Alignment
EIYKRWIIL epitope logo
Epitope Name Gag EIL9
Subtype B
Species (MHC/HLA) human(A*24:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53245

Download this epitope record as JSON.

HXB2 Location Gag(269-277)
p24(137-145)
DNA(1594..1620)
Gag Epitope Map
Author Location Gag(269-277 SUMA)
Epitope GLNKIVRMY Epitope Alignment
GLNKIVRMY epitope logo
Epitope Name Gag GY9
Subtype B
Species (MHC/HLA) human(B*15:01)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53246

Download this epitope record as JSON.

HXB2 Location Gag(295-303)
p24(163-171)
DNA(1672..1698)
Gag Epitope Map
Author Location Gag(295-303 SUMA)
Epitope DYVDRFYKT Epitope Alignment
DYVDRFYKT epitope logo
Epitope Name Gag DT9
Subtype B
Species (MHC/HLA) human(A*24:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53222

Download this epitope record as JSON.

HXB2 Location Gag(298-308)
p24(166-176)
DNA(1681..1713)
Gag Epitope Map
Author Location Gag(295-305 BORI)
Epitope DRFYKTLRAEQ Epitope Alignment
DRFYKTLRAEQ epitope logo
Epitope Name Gag DQ11
Subtype B
Species (MHC/HLA) human(B*14:02)
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53247

Download this epitope record as JSON.

HXB2 Location Gag(305-313)
p24(173-181)
DNA(1702..1728)
Gag Epitope Map
Author Location Gag(305-313 SUMA)
Epitope RAEQASQEV Epitope Alignment
RAEQASQEV epitope logo
Epitope Name Gag RV9
Subtype B
Species (MHC/HLA) human(C*08:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53248

Download this epitope record as JSON.

HXB2 Location Gag(335-343)
p24(203-211)
DNA(1792..1818)
Gag Epitope Map
Author Location Gag(335-343 SUMA)
Epitope KALGPAATL Epitope Alignment
KALGPAATL epitope logo
Epitope Name Gag KL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53249

Download this epitope record as JSON.

HXB2 Location Gag(349-359)
p24(217-227)
DNA(1834..1866)
Gag Epitope Map
Author Location Gag(349-359 SUMA)
Epitope ACQGVGGPGHK Epitope Alignment
ACQGVGGPGHK epitope logo
Epitope Name Gag AK11
Subtype B
Species (MHC/HLA) human(A*11:03)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62980

Download this epitope record as JSON.

HXB2 Location Gag(411-440)
p2p7p1p6(48-77)
Gag Epitope Map
Author Location Gag(410-440 SUMA)
Epitope RGCWKCGKEGHQMKDCTERQANFFGKIWPS Epitope Alignment
Epitope Name Gag 410-400
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63033

Download this epitope record as JSON.

HXB2 Location Pol(147-155)
Protease(91-99)
Pol Epitope Map
Author Location ( SUMA)
Epitope TQIGCTLNF Epitope Alignment
TQIGCTLNF epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63030

Download this epitope record as JSON.

HXB2 Location Pol(375-383)
RT(220-228)
Pol Epitope Map
Author Location ( SUMA)
Epitope KHQKEPPFL Epitope Alignment
KHQKEPPFL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63031

Download this epitope record as JSON.

HXB2 Location Pol(418-426)
RT(263-271)
Pol Epitope Map
Author Location ( SUMA)
Epitope KLNWASQIY Epitope Alignment
KLNWASQIY epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63029

Download this epitope record as JSON.

HXB2 Location Pol(775-783)
Integrase(60-68)
Pol Epitope Map
Author Location ( SUMA)
Epitope IWQLDCTHL Epitope Alignment
IWQLDCTHL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 63032

Download this epitope record as JSON.

HXB2 Location Pol(781-789)
Integrase(66-74)
Pol Epitope Map
Author Location ( SUMA)
Epitope THLEGKVIL Epitope Alignment
THLEGKVIL epitope logo
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53250

Download this epitope record as JSON.

HXB2 Location Tat(12-21)
DNA(5864..5893)
Tat Epitope Map
Author Location Tat(12-21 SUMA)
Epitope KHPGSQPKTA Epitope Alignment
KHPGSQPKTA epitope logo
Epitope Name Tat KA10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53233

Download this epitope record as JSON.

HXB2 Location Tat(24-32)
DNA(5900..5926)
Tat Epitope Map
Author Location Tat(24-32 WEAU)
Epitope NCYCKRCCF Epitope Alignment
NCYCKRCCF epitope logo
Show epitope variants
Epitope Name Tat NF9
Subtype B
Species (MHC/HLA) human(A*29:02)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53225

Download this epitope record as JSON.

HXB2 Location Tat(24-32)
DNA(5900..5926)
Tat Epitope Map
Author Location Tat(24-32 BORI)
Epitope NCYCKKCCY Epitope Alignment
NCYCKKCCY epitope logo
Show epitope variants
Epitope Name Tat NY9
Subtype B
Species (MHC/HLA) human(A*29:02)
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53235

Download this epitope record as JSON.

HXB2 Location Tat(32-41)
DNA(5924..5953)
Tat Epitope Map
Author Location Tat(32-41 SUMA)
Epitope FHCQVCFMTK Epitope Alignment
FHCQVCFMTK epitope logo
Show epitope variants
Epitope Name Tat FK10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, epitope processing, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53236

Download this epitope record as JSON.

HXB2 Location Tat(36-45)
DNA(5936..5965)
Tat Epitope Map
Author Location Tat(36-45 SUMA)
Epitope VCFMTKGLGI Epitope Alignment
VCFMTKGLGI epitope logo
Show epitope variants
Epitope Name Tat VI10
Subtype B
Species (MHC/HLA) human(B*15:01)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, epitope processing, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53237

Download this epitope record as JSON.

HXB2 Location Tat(39-47)
DNA(5945..5971)
Tat Epitope Map
Author Location Tat(39-47 SUMA)
Epitope MTKGLGISY Epitope Alignment
MTKGLGISY epitope logo
Show epitope variants
Epitope Name Tat MY9
Subtype B
Species (MHC/HLA) human(B*15:01)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, epitope processing, immunodominance, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53226

Download this epitope record as JSON.

HXB2 Location gp160(31-39)
gp120(31-39)
DNA(6315..6341)
gp160 Epitope Map
Author Location gp160(30-38 WEAU)
Epitope AENLWVTVY Epitope Alignment
AENLWVTVY epitope logo
Show epitope variants
Epitope Name gp160 AY9
Subtype B
Species (MHC/HLA) human(B*44:03)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53238

Download this epitope record as JSON.

HXB2 Location gp160(32-40)
gp120(32-40)
DNA(6318..6344)
gp160 Epitope Map
Author Location gp160(29-37 SUMA)
Epitope ENLWVTVYY Epitope Alignment
ENLWVTVYY epitope logo
Epitope Name gp160 EY9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62972

Download this epitope record as JSON.

HXB2 Location gp160(164-183)
gp120(164-183)
gp160 Epitope Map
Author Location gp160(160-180 SUMA)
Epitope NMRDKKQKEYALFYNLDIVQ Epitope Alignment
NMRDKKQKEYALFYNLDIVQ epitope logo
Epitope Name gp160 160-180
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53219

Download this epitope record as JSON.

HXB2 Location gp160(209-217)
gp120(209-217)
DNA(6849..6875)
gp160 Epitope Map
Author Location gp160(207-215 BORI, WEAU)
Epitope SFEPIPIHY Epitope Alignment
SFEPIPIHY epitope logo
Show epitope variants
Epitope Name gp160 SY9
Subtype B
Species (MHC/HLA) human(A*29:02)
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44; BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53220

Download this epitope record as JSON.

HXB2 Location gp160(239-247)
gp120(239-247)
DNA(6939..6965)
gp160 Epitope Map
Author Location gp160(237-245 BORI)
Epitope CKNVSTVQC Epitope Alignment
CKNVSTVQC epitope logo
Show epitope variants
Epitope Name gp160 CC9
Subtype B
Species (MHC/HLA) human(C*08:02)
Immunogen HIV-1 infection
Patient MHC/HLA BORI: A02, A29, B14, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, kinetics, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53227

Download this epitope record as JSON.

HXB2 Location gp160(310-318)
gp120(310-318)
DNA(7152..7178)
gp160 Epitope Map
Author Location gp160(313-321 WEAU)
Epitope TLGPGRVLY Epitope Alignment
TLGPGRVLY epitope logo
Epitope Name gp160 TY9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53234

Download this epitope record as JSON.

HXB2 Location gp160(344-361)
gp120(344-361)
DNA(7254..7307)
gp160 Epitope Map
Author Location gp160(348-366 WEAU)
Epitope QIVEKLREIKQFKNKTIVF Epitope Alignment
QIVEKLREIKQFKNKTIVF epitope logo
Show epitope variants
Epitope Name gp160 348-366
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, escape, acute/early infection, kinetics, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.


Displaying record number 53239

Download this epitope record as JSON.

HXB2 Location gp160(377-386)
gp120(377-386)
DNA(7353..7382)
gp160 Epitope Map
Author Location gp160(374-383 SUMA)
Epitope NCGGEFFYCN Epitope Alignment
NCGGEFFYCN epitope logo
Epitope Name gp160 NN10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53240

Download this epitope record as JSON.

HXB2 Location gp160(383-391)
gp120(383-391)
DNA(7371..7397)
gp160 Epitope Map
Author Location gp160(380-389 SUMA)
Epitope FYCNTTQLF Epitope Alignment
FYCNTTQLF epitope logo
Epitope Name gp160 FF9
Subtype B
Species (MHC/HLA) human(A*24:02)
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62975

Download this epitope record as JSON.

HXB2 Location gp160(393-402)
gp120(393-402)
gp160 Epitope Map
Author Location gp160(390-401 SUMA)
Epitope STWYINNTGNGA Epitope Alignment
STWYINNTGNGA epitope logo
Epitope Name gp160 390-401
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62974

Download this epitope record as JSON.

HXB2 Location gp160(403-417)
gp120(403-417)
gp160 Epitope Map
Author Location gp160(410-425 SUMA)
Epitope KGSDNTDTIKLP Epitope Alignment
KGSDNTDTIKLP epitope logo
Epitope Name gp160 410-425
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62973

Download this epitope record as JSON.

HXB2 Location gp160(414-429)
gp120(414-429)
gp160 Epitope Map
Author Location gp160(410-425 SUMA)
Epitope IKLPCRIKQIINMWQE Epitope Alignment
IKLPCRIKQIINMWQE epitope logo
Epitope Name gp160 410-425
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62976

Download this epitope record as JSON.

HXB2 Location gp160(430-445)
gp120(430-445)
gp160 Epitope Map
Author Location gp160(390-401 SUMA)
Epitope VGKAMYAPPIRGQIRC Epitope Alignment
VGKAMYAPPIRGQIRC epitope logo
Epitope Name gp160 390-401
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 62971

Download this epitope record as JSON.

HXB2 Location gp160(443-452)
gp120(443-452)
gp160 Epitope Map
Author Location gp160(439-448 SUMA)
Epitope IRCSSNITGL Epitope Alignment
IRCSSNITGL epitope logo
Epitope Name gp160 IL10
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53241

Download this epitope record as JSON.

HXB2 Location gp160(486-494)
gp120(486-494)
DNA(7680..7706)
gp160 Epitope Map
Author Location gp160(485-493 SUMA)
Epitope YKVVKIEPL Epitope Alignment
YKVVKIEPL epitope logo
Epitope Name gp160 YL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53221

Download this epitope record as JSON.

HXB2 Location gp160(584-592)
gp41(73-81)
DNA(7974..8000)
gp160 Epitope Map
Author Location gp160(598-597 BORI, SUMA)
Epitope ERYLKDQQL Epitope Alignment
ERYLKDQQL epitope logo
Show epitope variants
Epitope Name gp160 EL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA A*11:03, A*24:02, B*14:02, B*15:01, C*08:02; BORI: A02, A29, B14, B44; SUMA: A*11:03, A*24:02, B*14:02, B*15:01, C*08:02, C*12:03
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, escape, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53228

Download this epitope record as JSON.

HXB2 Location gp160(824-832)
gp41(313-321)
DNA(8694..8720)
gp160 Epitope Map
Author Location gp160(828-836 WEAU)
Epitope EGTDRIVIEI Epitope Alignment
EGTDRIVIEI epitope logo
Epitope Name gp160 EI9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Displaying record number 53229

Download this epitope record as JSON.

HXB2 Location gp160(833-841)
gp41(322-330)
DNA(8721..8747)
gp160 Epitope Map
Author Location gp160(837-845 WEAU)
Epitope VQRTCRAIL Epitope Alignment
VQRTCRAIL epitope logo
Epitope Name gp160 VL9
Subtype B
Species (MHC/HLA) human
Immunogen HIV-1 infection
Patient MHC/HLA WEAU: A01, A29, B08, B44
Country United States
Experimental methods CD8 T-cell Elispot - IFNγ, Chromium-release assay
Keywords dynamics, immunodominance, acute/early infection, autologous responses, optimal epitope

Notes

References

Jones2004 Nicola A. Jones, Xiping Wei, Darren R. Flower, MaiLee Wong, Franziska Michor, Michael S. Saag, Beatrice H. Hahn, Martin A. Nowak, George M. Shaw, and Persephone Borrow. Determinants of Human Immunodeficiency Virus Type 1 Escape from the Primary CD8+ Cytotoxic T Lymphocyte Response. J. Exp. Med., 200(10):1243-1256, 15 Nov 2004. PubMed ID: 15545352. Show all entries for this paper.

Yang2019 Yiding Yang, and Vitaly V. Ganusov. Defining Kinetic Properties of HIV-Specific CD8(+) T-Cell Responses in Acute Infection. Microorganisms, 7(3):microorganisms7030069 doi, Mar 2019. PubMed ID: 30836625 Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health