Search CTL/CD8+ T-Cell Epitope Database

Found 8 matching records:

Displaying record number 62733

Download this epitope record as JSON.

HXB2 Location	Gag(147-155) p24(15-23) DNA(1228..1254)	Gag Epitope Map
Author Location	p24
Epitope	`ISPRTLNAW`	Epitope Alignment
Epitope Name	B57-ISW9
Species (MHC/HLA)	human
Immunogen	in vitro stimulation or selection
Experimental methods	In vitro proteasome digestion
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with MVHQAISPRTLNAWVKVVEEKAFSPEVIPMFAALS, cytosolic extracts from CD3/CD28-stimulated CD4+ T cells, vs. from resting CD4+ T cells, produced significantly less N-extended precursors containing epitope ISPRTLNAW. ISPRTLNAW is known to be restricted to B57.

References

Boucau2019 Julie Boucau, Julien Madouasse, Georgio Kourjian, Christopher S. Carlin, Daniel Wambua, Matthew J. Berberich, and Sylvie Le Gall. The Activation State of CD4 T Cells Alters Cellular Peptidase Activities, HIV Antigen Processing, and MHC Class I Presentation in a Sequence-Dependent Manner. J. Immunol., 202(10):2856-2872, 15 May 2019. PubMed ID: 30936293. Show all entries for this paper.

Displaying record number 62732

Download this epitope record as JSON.

HXB2 Location	Gag(160-168) p24(28-36) DNA(1267..1293)	Gag Epitope Map
Author Location	p24
Epitope	`EEKAFSPEV`	Epitope Alignment
Epitope Name	B44-EV9
Species (MHC/HLA)	human
Immunogen	in vitro stimulation or selection
Experimental methods	In vitro proteasome digestion
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with MVHQAISPRTLNAWVKVVEEKAFSPEVIPMFAALS, cytosolic extracts from CD3/CD28-stimulated CD4+ T cells, vs. from resting CD4+ T cells, produced significantly more N-extended precursors containing epitope EEKAFSPEV. EEKAFSPEV is known to be restricted to B44.

References

Displaying record number 62731

Download this epitope record as JSON.

HXB2 Location	Gag(162-169) p24(30-37) DNA(1273..1296)	Gag Epitope Map
Author Location	p24
Epitope	`KAFSPEVI`	Epitope Alignment
Epitope Name	B57-KI8
Species (MHC/HLA)	human
Immunogen	in vitro stimulation or selection
Experimental methods	In vitro proteasome digestion
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with MVHQAISPRTLNAWVKVVEEKAFSPEVIPMFAALS, cytosolic extracts from CD3/CD28-stimulated CD4+ T cells, vs. from resting CD4+ T cells, produced significantly more optimal epitope KAFSPEVI. KAFSPEVI is known to be restricted to B57.

References

Displaying record number 62736

Download this epitope record as JSON.

HXB2 Location	Gag(162-172) p24(30-40) DNA(1273..1305)	Gag Epitope Map
Author Location	p24
Epitope	`KAFSPEVIPMF`	Epitope Alignment
Epitope Name	KF11
Species (MHC/HLA)	human(B*57)
Immunogen	in vitro stimulation or selection, engineered
Experimental methods	Degranulation, CD107a and b cell surface mobilization, In vitro proteasome digestion, Other, Peptide titration
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with KVVEEKAFSPEVIPMFSAL (5-KF11-3), cytosolic extracts from CD3/CD28-stimulated HLA-B57+ primary CD4+ T cells, vs. from similar resting CD4+ T cells, produced higher amounts faster of N-extended precursors containing epitope KAFSPEVIPMF (KF11). Optimal KF11 epitope was detected in cytosolic extracts from both stimulated and unstimulated CD4+ T cells, but only at the earliest time point (2 hrs post-digestion) which is likely due to cleavage sites within KF11.
KF11-specific CTL degranulation and CD4+ surface display was higher, but peaked earlier with a steep decline, in the presence of NL4-3-δEnv psuedotyped with VSVg-infected CD3/CD28-stimulated HLA-B57+ primary CD4+ T cells vs. similar unstimulated CD4+ T cells.

References

Displaying record number 62734

Download this epitope record as JSON.

HXB2 Location	Gag(167-175) p24(35-43) DNA(1288..1314)	Gag Epitope Map
Author Location	p24
Epitope	`EVIPMFAAL`	Epitope Alignment
Epitope Name	A26-EL9
Species (MHC/HLA)	human
Immunogen	in vitro stimulation or selection
Experimental methods	In vitro proteasome digestion
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with MVHQAISPRTLNAWVKVVEEKAFSPEVIPMFAALS, cytosolic extracts from CD3/CD28-stimulated CD4+ T cells, vs. from resting CD4+ T cells, produced significantly less N-extended precursors containing epitope EVIPMFAAL. EVIPMFAAL is known to be restricted to A26.

References

Displaying record number 62735

Download this epitope record as JSON.

HXB2 Location	Gag(168-175) p24(36-43) DNA(1291..1314)	Gag Epitope Map
Author Location	p24
Epitope	`VIPMFAAL`	Epitope Alignment
Epitope Name	Cw01-VL8
Species (MHC/HLA)	human
Immunogen	in vitro stimulation or selection
Experimental methods	In vitro proteasome digestion
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with MVHQAISPRTLNAWVKVVEEKAFSPEVIPMFAALS, cytosolic extracts from CD3/CD28-stimulated CD4+ T cells, vs. from resting CD4+ T cells, produced significantly less N-extended precursors containing epitope VIPMFAAL. VIPMFAAL is known to be restricted to Cw01.

References

Displaying record number 62737

Download this epitope record as JSON.

HXB2 Location	Gag(240-249) p24(108-117) DNA(1507..1536)	Gag Epitope Map
Author Location	p24
Epitope	`TSTLQEQIGW`	Epitope Alignment
Epitope Name	TW10
Species (MHC/HLA)	human(B*57)
Immunogen	in vitro stimulation or selection, engineered
Experimental methods	Degranulation, CD107a and b cell surface mobilization, In vitro proteasome digestion, Other, Peptide titration
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with DIAGTTSTLQEQIGWMTN (5-TW10-3), cytosolic extracts from CD3/CD28-stimulated HLA-B57+ primary CD4+ T cells, vs. from similar resting CD4+ T cells, produced higher amounts faster of N-extended precursors containing epitope TSTLQEQIGW (TW10) while optimal TW10 epitope was only detected in the former.
TW10-specific CTL degranulation and CD4+ surface display was higher, but peaked earlier, in the presence of NL4-3-δEnv psuedotyped with VSVg-infected CD3/CD28-stimulated HLA-B57+ primary CD4+ T cells vs. similar unstimulated CD4+ T cells.

References

Displaying record number 62730

Download this epitope record as JSON.

HXB2 Location	Pol(313-321) RT(158-166) DNA(3021..3047)	Pol Epitope Map
Author Location	RT
Epitope	`AIFQSSMTK`	Epitope Alignment
Epitope Name	ATK9
Species (MHC/HLA)	human(A*03)
Immunogen	in vitro stimulation or selection
Experimental methods	Chromium-release assay, In vitro proteasome digestion
Keywords	epitope processing

Notes

Cellular activation of CD4+ T cells affects the expression and activity of peptidases, the kinetics and patterns of in vitro degradation of Ags, and the endogenous processing of MHC-I HIV epitopes by HIV-infected CD4+ T cells which results in altered kinetics and efficiency of CTL recognition. When incubated with cytosolic extracts from activated CD4+ T cells, vs. resting CD4+ T cells, peptides were generally degraded more quickly with differential usages of specific sequence-based cleavage sites which resulted in fewer peptides containing intact epitopes.
When incubated with a synthetic 16mer, WKGSPAIFQSSMTKIL (5-ATK9-2), cytosolic extracts from CD3/CD28-stimulated CD4+ T cells, vs. from resting CD4+ T cells, produced less optimal CTL epitope AIFQSSMTK (ATK9), fewer precursors containing ATK9, and less 8-12mer peptides while producing more antitopes (a non-functional peptide that is generated by proteasomal cleavage within the epitope, resulting in partial overlaps with the functional epitope i.e. a peptide cleaved within the epitope) and fragments <7 aa long. AIFQSSMTK is known to be restricted to A*03:01/11:01.
In a chromium release assay with HLA-A03 ATK9-specific CTLs, the in vitro degradation products produced by CD3/CD28-stimulated CD4+ T-cell cytosolic extracts were significantly less antigenic than those produced by resting CD4+ T-cell cytosolic extracts and there was a positive correlation between the production of optimal ATK9 epitope and antigenicity.