Found 1 matching record:
Download this epitope record as JSON.
MAb ID | 4B3 | |
---|---|---|
HXB2 Location | Env(578-612) DNA(7956..8060) |
Env Epitope Map |
Author Location | gp41(579-613 BH10) | |
Research Contact | H. Katinger, Inst. Appl. Microbiol., Vienna, Austria | |
Epitope |
ARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNA ?
|
Epitope Alignment |
Subtype | B | |
Ab Type | gp41 cluster I | |
Neutralizing | no | |
Species (Isotype) | human(IgG1λ) | |
Patient | ||
Immunogen | HIV-1 infection | |
Keywords | effector function, review, SIV |
Showing 2 matching of 5 total notes.
Showing 2 matching of 7 total references.
Moog2014 C. Moog, N. Dereuddre-Bosquet, J.-L. Teillaud, M. E. Biedma, V. Holl, G. Van Ham, L. Heyndrickx, A. Van Dorsselaer, D. Katinger, B. Vcelar, S. Zolla-Pazner, I. Mangeot, C. Kelly, R. J. Shattock, and R. Le Grand. Protective Effect of Vaginal Application of Neutralizing and Nonneutralizing Inhibitory Antibodies Against Vaginal SHIV Challenge in Macaques. Mucosal Immunol., 7(1):46-56, Jan 2014. PubMed ID: 23591718. Show all entries for this paper.
Pollara2013 Justin Pollara, Mattia Bonsignori, M. Anthony Moody, Marzena Pazgier, Barton F. Haynes, and Guido Ferrari. Epitope Specificity of Human Immunodeficiency Virus-1 Antibody Dependent Cellular Cytotoxicity (ADCC) Responses. Curr. HIV Res., 11(5):378-387, Jul 2013. PubMed ID: 24191939. Show all entries for this paper.
This is a legacy search page. It is deprecated, will receive no more updates, and will eventually be removed. Please use the new search pages.