logo image

HIV Molecular Immunology Database

Search Antibody Database

Found 1 matching record:

Displaying record number 790

Download this epitope record as JSON.

MAb ID 4B3
HXB2 Location Env(578-612)
DNA(7956..8060)
Env Epitope Map
Author Location gp41(579-613 BH10)
Research Contact H. Katinger, Inst. Appl. Microbiol., Vienna, Austria
Epitope ARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNA ? Epitope Alignment
Subtype B
Ab Type gp41 cluster I
Neutralizing no
Species (Isotype) human(IgG1λ)
Patient  
Immunogen HIV-1 infection
Keywords effector function, review, SIV

Notes

Showing 2 matching of 5 total notes.

References

Showing 2 matching of 7 total references.

Moog2014 C. Moog, N. Dereuddre-Bosquet, J.-L. Teillaud, M. E. Biedma, V. Holl, G. Van Ham, L. Heyndrickx, A. Van Dorsselaer, D. Katinger, B. Vcelar, S. Zolla-Pazner, I. Mangeot, C. Kelly, R. J. Shattock, and R. Le Grand. Protective Effect of Vaginal Application of Neutralizing and Nonneutralizing Inhibitory Antibodies Against Vaginal SHIV Challenge in Macaques. Mucosal Immunol., 7(1):46-56, Jan 2014. PubMed ID: 23591718. Show all entries for this paper.

Pollara2013 Justin Pollara, Mattia Bonsignori, M. Anthony Moody, Marzena Pazgier, Barton F. Haynes, and Guido Ferrari. Epitope Specificity of Human Immunodeficiency Virus-1 Antibody Dependent Cellular Cytotoxicity (ADCC) Responses. Curr. HIV Res., 11(5):378-387, Jul 2013. PubMed ID: 24191939. Show all entries for this paper.


This is a legacy search page. It is deprecated, will receive no more updates, and will eventually be removed. Please use the new search pages.

Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Copyright Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services LANL logo National Institutes of Health logo