HIV molecular immunology database

 

Search Antibody Database

Found 2 matching records:

Displaying record number 748

Download this epitope record as JSON.

MAb ID 86 (No. 86)
HXB2 Location gp160(579-613)
DNA(7959..8063)
gp160 Epitope Map
Author Location gp41(586-620 IIIB)
Research Contact Evan Hersh and Yoh-Ichi Matsumoto
Epitope RILAVERYLKDQQLLGIWGCSGKLICTTAVPWNAS Epitope Alignment
Ab Type  
Neutralizing  
Species (Isotype) human(IgG1κ)
Patient  
Immunogen HIV-1 infection
Keywords antibody binding site, antibody generation, antibody sequence, complement, enhancing activity, immunotoxin, review, variant cross-reactivity

Notes

Showing 10 of 10 notes.

References

Showing 9 of 9 references.

Isolation Paper
Sugano1988 T. Sugano, Y. Masuho, Y.-I. Matsumoto, D. Lake, C. Gschwind, E. A. Petersen, and E. M. Hersh. Human monoclonal antibody against glycoproteins of human immunodeficiency virus. Biochem. Biophys. Res. Commun., 155:1105-1112, 1988. PubMed ID: 2845963. Show all entries for this paper.

Robinson1990a W. E. Robinson, Jr., T. Kawamura, M. K. Gorny, D. Lake, J.-Y. Xu, Y. Matsumoto, T. Sugano, Y. Masuho, W. M. Mitchell, E. Hersh, and S. Zolla-Pazner. Human Monoclonal Antibodies to the Human Immunodeficiency Virus Type 1 (HIV-1) Transmembrane Glycoprotein gp41 Enhance HIV-1 Infection In Vitro. Proc. Natl. Acad. Sci. U.S.A., 87:3185-3189, 1990. Three gp41 MAbs out of 16 Env and Gag MAbs tested enhanced HIV-1 IIIB infection of MT-2 cells. The enhancing antibodies were competitive with the immunodominant epitopes of gp41 recognized by sera from HIV-1 infected subjects. PubMed ID: 2326277. Show all entries for this paper.

Robinson1990b W. E. Robinson, Jr., T. Kawamura, D. Lake, Y. Masuho, W. M. Mitchell, and E. M. Hersh. Antibodies to the Primary Immunodominant Domain of Human Immunodeficiency Virus Type 1 (HIV-1) Glycoprotein gp41 Enhance HIV-1 Infection In Vitro. J. Virol., 64:5301-5305, 1990. PubMed ID: 1698995. Show all entries for this paper.

Pincus1991 S. H. Pincus, R. L. Cole, E. M. Hersh, D. Lake, Y. Masuho, P. J. Durda, and J. McClure. In Vitro Efficacy of Anti-HIV Immunotoxins Targeted by Various Antibodies to the Envelope Protein. J. Immunol., 146:4315-4324, 1991. Six MAbs, (907, 924, 110.1, 41.1, 86 and P5-3) and polyclonal pooled serum antibodies purified on gp160 were coupled to RAC to create immunotoxins. Only 41.1-RAC, an anti-gp41 MAb-immunotoxin and the polyclonal immunotoxin showed direct activity against multiple strains, and activity of an immunotoxin was found not to be directly correlated with cell surface binding. PubMed ID: 1710247. Show all entries for this paper.

Moran1993 M. J. Moran, J. S. Andris, Y.-I. Matsumato, J. D. Capra, and E. M. Hersh. Variable Region Genes of Anti-HIV Human Monoclonal Antibodies: Non-Restricted Use of the V Gene Repertoire and Extensive Somatic Mutation. Mol. Immunol., 30:1543-1551, 1993. Sequenced variable regions from four human anti-HIV-1 MAbs: anti-gp120 13, S1-1 and HBW4; and anti-gp41 No.86. Extensive somatic mutation was observed and under-representation of V$_H$ III usage. PubMed ID: 8232339. Show all entries for this paper.

Wisnewski1996 A. Wisnewski, L. Cavacini, and M. Posner. Human antibody variable region gene usage in HIV-1 infection. J. Acquir. Immune Defic. Syndr. Hum. Retrovirol., 11:31-38, 1996. PubMed ID: 8528730. Show all entries for this paper.

Mitchell1998 W. M. Mitchell, L. Ding, and J. Gabriel. Inactivation of a Common Epitope Responsible for the Induction of Antibody-Dependent Enhancement of HIV. AIDS, 12:147-156, 1998. PubMed ID: 9468363. Show all entries for this paper.

Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.

Gorny2009 Miroslaw K. Gorny, Xiao-Hong Wang, Constance Williams, Barbara Volsky, Kathy Revesz, Bradley Witover, Sherri Burda, Mateusz Urbanski, Phillipe Nyambi, Chavdar Krachmarov, Abraham Pinter, Susan Zolla-Pazner, and Arthur Nadas. Preferential Use of the VH5-51 Gene Segment by the Human Immune Response to Code for Antibodies against the V3 Domain of HIV-1. Mol. Immunol., 46(5):917-926, Feb 2009. PubMed ID: 18952295. Show all entries for this paper.


Displaying record number 747

Download this epitope record as JSON.

MAb ID V10-9
HXB2 Location gp160(580-613)
DNA(7962..8063)
gp160 Epitope Map
Author Location gp41(586-620 IIIB)
Epitope ILAVERYLKDQQLLGIWGCSGKLICTTAVPWNAS Epitope Alignment
Ab Type  
Neutralizing  
Species (Isotype) human(IgG1κ)
Patient  
Immunogen HIV-1 infection
Keywords antibody interactions, enhancing activity, review

Notes

Showing 3 of 3 notes.

References

Showing 3 of 3 references.

Robinson1990a W. E. Robinson, Jr., T. Kawamura, M. K. Gorny, D. Lake, J.-Y. Xu, Y. Matsumoto, T. Sugano, Y. Masuho, W. M. Mitchell, E. Hersh, and S. Zolla-Pazner. Human Monoclonal Antibodies to the Human Immunodeficiency Virus Type 1 (HIV-1) Transmembrane Glycoprotein gp41 Enhance HIV-1 Infection In Vitro. Proc. Natl. Acad. Sci. U.S.A., 87:3185-3189, 1990. Three gp41 MAbs out of 16 Env and Gag MAbs tested enhanced HIV-1 IIIB infection of MT-2 cells. The enhancing antibodies were competitive with the immunodominant epitopes of gp41 recognized by sera from HIV-1 infected subjects. PubMed ID: 2326277. Show all entries for this paper.

Robinson1990b W. E. Robinson, Jr., T. Kawamura, D. Lake, Y. Masuho, W. M. Mitchell, and E. M. Hersh. Antibodies to the Primary Immunodominant Domain of Human Immunodeficiency Virus Type 1 (HIV-1) Glycoprotein gp41 Enhance HIV-1 Infection In Vitro. J. Virol., 64:5301-5305, 1990. PubMed ID: 1698995. Show all entries for this paper.

Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health