HIV molecular immunology database

 

Search Antibody Database

Found 4 matching records:

Displaying record number 37

Download this epitope record as JSON.

MAb ID 2A6
HXB2 Location Gag Gag Epitope Map
Author Location p17
Research Contact A. O. Arthur, Frederick Cancer Research and Development Center, Frederick, MD
Epitope
Ab Type  
Neutralizing  
Species (Isotype)  
Patient  
Immunogen  
Keywords  

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Pincus1998 S. H. Pincus, R. L. Cole, R. Watson-McKown, A. Pinter, W. Honnen, B. Cole, and K. S. Wise. Immunologic Cross-Reaction between HIV Type 1 p17 and Mycoplasma hyorhinis Variable Lipoprotein. AIDS Res. Hum. Retroviruses, 14:419-425, 1998. PubMed ID: 9546801. Show all entries for this paper.


Displaying record number 38

Download this epitope record as JSON.

MAb ID G11H3 (12A-Gllh3)
HXB2 Location Gag Gag Epitope Map
Author Location p17
Epitope
Ab Type  
Neutralizing  
Species (Isotype) rat(IgG2a)
Patient  
Immunogen  
Keywords antibody generation

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Isolation Paper
Shang1991 F. Shang, H. Huang, K. Revesz, H.-C. Chen, R. Herz, and A. Pinter. Characterization of monoclonal antibodies against the human immunodeficiency virus matrix protein, p17gag: identification of epitopes exposed at the surfaces of infected cells. J. Virol., 65:4798-4804, 1991. Six MAbs with linear epitopes were mapped. These Abs could only bind to HIV-infected cells that had been permeablized with acetone. Only G11g1 and G11h3, two antibodies that did not bind to peptides, but only to intact p17, could react with live HIV-1 infected cells. These antibodies were not neutralizing. PubMed ID: 1714518. Show all entries for this paper.

Pincus1998 S. H. Pincus, R. L. Cole, R. Watson-McKown, A. Pinter, W. Honnen, B. Cole, and K. S. Wise. Immunologic Cross-Reaction between HIV Type 1 p17 and Mycoplasma hyorhinis Variable Lipoprotein. AIDS Res. Hum. Retroviruses, 14:419-425, 1998. PubMed ID: 9546801. Show all entries for this paper.


Displaying record number 488

Download this epitope record as JSON.

MAb ID 924
HXB2 Location gp160(304-314)
DNA(7134..7166)
gp160 Epitope Map
Author Location gp120(309-318 IIIB)
Epitope RKSIRIQRGPG Epitope Alignment
RKSIRIQRGPG epitope logo
Ab Type gp120 V3 // V3 glycan (V3g)
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type vaccinia
Vaccine strain B clade IIIB
Vaccine component gp160

Notes

Showing 6 of 6 notes.

References

Showing 7 of 7 references.

Chesebro1988 B. Chesebro and K. Wehrly. Development of a Sensitive Quantitative Focal Assay for Human Immunodeficiency Virus Infectivity. J. Virol., 62:3779-3788, 1988. PubMed ID: 3047430. Show all entries for this paper.

Pincus1991 S. H. Pincus, R. L. Cole, E. M. Hersh, D. Lake, Y. Masuho, P. J. Durda, and J. McClure. In Vitro Efficacy of Anti-HIV Immunotoxins Targeted by Various Antibodies to the Envelope Protein. J. Immunol., 146:4315-4324, 1991. Six MAbs, (907, 924, 110.1, 41.1, 86 and P5-3) and polyclonal pooled serum antibodies purified on gp160 were coupled to RAC to create immunotoxins. Only 41.1-RAC, an anti-gp41 MAb-immunotoxin and the polyclonal immunotoxin showed direct activity against multiple strains, and activity of an immunotoxin was found not to be directly correlated with cell surface binding. PubMed ID: 1710247. Show all entries for this paper.

Pincus1993 S. H. Pincus and J. McClure. Soluble CD4 Enhances the Efficacy of Immunotoxins Directed against gp41 of the Human Immunodeficiency Virus. Proc. Natl. Acad. Sci. U.S.A., 90:332-336, 1993. PubMed ID: 8419938. Show all entries for this paper.

Pincus1993a S. H. Pincus, K. G. Messer, D. H. Schwartz, G. K. Lewis, B. S. Graham, W. A. Blattner, and G. Fisher. Differences in the Antibody Response to Human Immunodeficiency Virus-1 Envelope Glycoprotein (gp160) in Infected Laboratory Workers and Vaccinees. J. Clin. Invest., 91:1987-1996, 1993. PubMed ID: 7683694. Show all entries for this paper.

Cook1994 D. G. Cook, J. Fantini, S. L. Spitalnik, and F. Gonzalez-Scarano. Binding of Human Immunodeficiency Virus Type 1 HIV-1 gp120 to Galactosylceramide (GalCer): Relationship to the V3 Loop. Virol., 201:206-214, 1994. Antibodies against GalCer can block infection of CD4-negative cells from the brain and colon that are susceptible to HIV infection. This paper explores the ability of a panel of MAbs to inhibit binding of gp120 to GalCer, and also of the binding of GalCer to inhibit MAb-gp120 interaction. MAbs to the V3 loop and GalCer showed mutual inhibition of binding to gp120, and anti-CD4 binding site MAbs showed reduced inhibition. N- and C-terminal MAbs didn't influence GalCer binding. PubMed ID: 8184533. Show all entries for this paper.

Pincus1996 S. H. Pincus, K. Wehrly, R. Cole, H. Fang, G. K. Lewis, J. McClure, A. J. Conley, B. Wahren, M. R. Posner, A. L. Notkins, S. A. Tilley, A. Pinter, L. Eiden, M. Teintze, D. Dorward, and V. V. Tolstikov. In Vitro Effects of Anti-HIV Immunotoxins Directed against Multiple Epitopes on HIV Type 1 Envelope Glycoprotein 160. AIDS Res. Hum. Retroviruses, 12:1041-1051, 1996. A panel of anti-gp160 MAbs to was used to construct anti-HIV immunotoxins by coupling antibodies to ricin A chain (RAC). The ability of the immunotoxins to kill HIV-1-infected cells was tested in tissue culture. Immunotoxins that bind epitopes on the cell surface killed infected cells, although killing was not directly proportional to binding. The activity of anti-gp41 immunotoxins was markedly enhanced in the presence of sCD4. PubMed ID: 8827220. Show all entries for this paper.

Pincus1998 S. H. Pincus, R. L. Cole, R. Watson-McKown, A. Pinter, W. Honnen, B. Cole, and K. S. Wise. Immunologic Cross-Reaction between HIV Type 1 p17 and Mycoplasma hyorhinis Variable Lipoprotein. AIDS Res. Hum. Retroviruses, 14:419-425, 1998. PubMed ID: 9546801. Show all entries for this paper.


Displaying record number 799

Download this epitope record as JSON.

MAb ID 41-1 (41.1, gp41-1)
HXB2 Location gp160(579-608)
DNA(7959..8048)
gp160 Epitope Map
Author Location gp41(584-609 LAV)
Epitope RILAVERYLKDQQLLGIWGCSGKLICTTAV Epitope Alignment
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords antibody binding site, antibody generation

Vaccine Details

Vaccine type protein
Vaccine component gp160

Notes

Showing 7 of 7 notes.

References

Showing 7 of 7 references.

Isolation Paper
Gosting1987 L. H. Gosting, J. McClure, E. S. Dickinson, S. M. Watanabe, K. Shriver, and L. C. Goldstein. Monoclonal antibodies to gp110 and gp41 of human immunodeficiency virus. J. Clin. Microbiol., 25:845-848, 1987. PubMed ID: 2438302. Show all entries for this paper.

Thomas1988 E. Kinney Thomas, J. N. Weber, J. McClure, P. R. Clapham, M. C. Singhal, M. K. Shriver, and R. A. Weiss. Neutralizing Monoclonal Antibodies to the AIDS Virus. AIDS, 2:25-29, 1988. PubMed ID: 2451922. Show all entries for this paper.

Mani1994 J.-C. Mani, V. Marchi, and C. Cucurou. Effect of HIV-1 Peptide Presentation on the Affinity Constants of Two Monoclonal Antibodies Determined by BIAcore Technology. Mol. Immunol., 31:439-444, 1994. Two MAbs are described; one 41-1 did not require the Cys-Cys disulfide bridge and loop formation, the other 9-11 depends on loop formation. PubMed ID: 7514268. Show all entries for this paper.

Pincus1991 S. H. Pincus, R. L. Cole, E. M. Hersh, D. Lake, Y. Masuho, P. J. Durda, and J. McClure. In Vitro Efficacy of Anti-HIV Immunotoxins Targeted by Various Antibodies to the Envelope Protein. J. Immunol., 146:4315-4324, 1991. Six MAbs, (907, 924, 110.1, 41.1, 86 and P5-3) and polyclonal pooled serum antibodies purified on gp160 were coupled to RAC to create immunotoxins. Only 41.1-RAC, an anti-gp41 MAb-immunotoxin and the polyclonal immunotoxin showed direct activity against multiple strains, and activity of an immunotoxin was found not to be directly correlated with cell surface binding. PubMed ID: 1710247. Show all entries for this paper.

Pincus1993 S. H. Pincus and J. McClure. Soluble CD4 Enhances the Efficacy of Immunotoxins Directed against gp41 of the Human Immunodeficiency Virus. Proc. Natl. Acad. Sci. U.S.A., 90:332-336, 1993. PubMed ID: 8419938. Show all entries for this paper.

Pincus1996 S. H. Pincus, K. Wehrly, R. Cole, H. Fang, G. K. Lewis, J. McClure, A. J. Conley, B. Wahren, M. R. Posner, A. L. Notkins, S. A. Tilley, A. Pinter, L. Eiden, M. Teintze, D. Dorward, and V. V. Tolstikov. In Vitro Effects of Anti-HIV Immunotoxins Directed against Multiple Epitopes on HIV Type 1 Envelope Glycoprotein 160. AIDS Res. Hum. Retroviruses, 12:1041-1051, 1996. A panel of anti-gp160 MAbs to was used to construct anti-HIV immunotoxins by coupling antibodies to ricin A chain (RAC). The ability of the immunotoxins to kill HIV-1-infected cells was tested in tissue culture. Immunotoxins that bind epitopes on the cell surface killed infected cells, although killing was not directly proportional to binding. The activity of anti-gp41 immunotoxins was markedly enhanced in the presence of sCD4. PubMed ID: 8827220. Show all entries for this paper.

Pincus1998 S. H. Pincus, R. L. Cole, R. Watson-McKown, A. Pinter, W. Honnen, B. Cole, and K. S. Wise. Immunologic Cross-Reaction between HIV Type 1 p17 and Mycoplasma hyorhinis Variable Lipoprotein. AIDS Res. Hum. Retroviruses, 14:419-425, 1998. PubMed ID: 9546801. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health