HIV molecular immunology database

 

Search Antibody Database

Found 5 matching records:

Displaying record number 59

Download this epitope record as JSON.

MAb ID polyclonal
HXB2 Location Gag(183-214)
DNA(1336..1431)
Gag Epitope Map
Author Location Gag(183-214 LAI)
Epitope DLNTMLNTVGGHQAAMQMLKETINEEAAEWDR Epitope Alignment
Epitope Name G1
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) human(IgG)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type lipopeptide
Vaccine strain B clade LAI
Vaccine component p24 Gag
Adjuvant QS21

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Pialoux2001 G. Pialoux, H. Gahery-Segard, S. Sermet, H. Poncelet, S. Fournier, L. Gerard, A. Tartar, H. Gras-Masse, J. P. Levy, J. G. Guillet, and \ANRS VAC 04 Study Team.\. Lipopeptides induce cell-mediated anti-HIV immune responses in seronegative volunteers. AIDS, 15(10):1239-49, 6 Jul 2001. PubMed ID: 11426068. Show all entries for this paper.


Displaying record number 60

Download this epitope record as JSON.

MAb ID polyclonal
HXB2 Location Gag(253-284)
DNA(1546..1641)
Gag Epitope Map
Author Location Gag(253-284 LAI)
Epitope NPPIPVGEIYKRWIILGLNKIVRMYSPTSILD Epitope Alignment
Epitope Name G2
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) human(IgG)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type lipopeptide
Vaccine strain B clade LAI
Vaccine component p24 Gag
Adjuvant QS21

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Pialoux2001 G. Pialoux, H. Gahery-Segard, S. Sermet, H. Poncelet, S. Fournier, L. Gerard, A. Tartar, H. Gras-Masse, J. P. Levy, J. G. Guillet, and \ANRS VAC 04 Study Team.\. Lipopeptides induce cell-mediated anti-HIV immune responses in seronegative volunteers. AIDS, 15(10):1239-49, 6 Jul 2001. PubMed ID: 11426068. Show all entries for this paper.


Displaying record number 61

Download this epitope record as JSON.

MAb ID polyclonal
HXB2 Location gp160(297-330)
DNA(7113..7214)
gp160 Epitope Map
Author Location Env(303-335 LAI)
Epitope TRPNNNTRKSIHIGPGRAFYATGEIIGDIRQAH Epitope Alignment
Epitope Name E
Subtype B
Ab Type gp120 V3 // V3 glycan (V3g)
Neutralizing  
Species (Isotype) human(IgG)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type lipopeptide
Vaccine strain B clade LAI
Vaccine component Env V3
Adjuvant QS21

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Pialoux2001 G. Pialoux, H. Gahery-Segard, S. Sermet, H. Poncelet, S. Fournier, L. Gerard, A. Tartar, H. Gras-Masse, J. P. Levy, J. G. Guillet, and \ANRS VAC 04 Study Team.\. Lipopeptides induce cell-mediated anti-HIV immune responses in seronegative volunteers. AIDS, 15(10):1239-49, 6 Jul 2001. PubMed ID: 11426068. Show all entries for this paper.


Displaying record number 65

Download this epitope record as JSON.

MAb ID polyclonal
HXB2 Location Nef(66-97)
DNA(8992..9087)
Nef Epitope Map
Author Location Nef(66-97 LAI)
Epitope VGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGL Epitope Alignment
Epitope Name N1
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) human(IgG)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type lipopeptide
Vaccine strain B clade LAI
Vaccine component Nef
Adjuvant QS21

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Pialoux2001 G. Pialoux, H. Gahery-Segard, S. Sermet, H. Poncelet, S. Fournier, L. Gerard, A. Tartar, H. Gras-Masse, J. P. Levy, J. G. Guillet, and \ANRS VAC 04 Study Team.\. Lipopeptides induce cell-mediated anti-HIV immune responses in seronegative volunteers. AIDS, 15(10):1239-49, 6 Jul 2001. PubMed ID: 11426068. Show all entries for this paper.


Displaying record number 66

Download this epitope record as JSON.

MAb ID polyclonal
HXB2 Location Nef(117-147)
DNA(9145..9237)
Nef Epitope Map
Author Location Nef(117-147 LAI)
Epitope TQGYFPDWQNYTPGPGVRYPLTFGWCYKLVP Epitope Alignment
Epitope Name N2
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) human(IgG)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type lipopeptide
Vaccine strain B clade LAI
Vaccine component Nef
Adjuvant QS21

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Pialoux2001 G. Pialoux, H. Gahery-Segard, S. Sermet, H. Poncelet, S. Fournier, L. Gerard, A. Tartar, H. Gras-Masse, J. P. Levy, J. G. Guillet, and \ANRS VAC 04 Study Team.\. Lipopeptides induce cell-mediated anti-HIV immune responses in seronegative volunteers. AIDS, 15(10):1239-49, 6 Jul 2001. PubMed ID: 11426068. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health