HIV molecular immunology database

 

Search Antibody Database

Found 17 matching records:

Displaying record number 10

Download this epitope record as JSON.

MAb ID 3E11
HXB2 Location Gag(19-38)
DNA(844..903)
Gag Epitope Map
Author Location p17(19-38 SIVmac)
Epitope IRLPGGKKKYMLKHVVWAA Epitope Alignment
IRLPGGKKKYMLKHVVWAA epitope logo
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type inactivated HIV
Vaccine strain B clade AGM TYO-7
Vaccine component HIV-1

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Otteken1992 A. Otteken, S. Nick, W. Bergter, G. Voss, A.C. Faisst, C. Stahl-Hennig, and G. Hunsmann. Identification of a gag protein epitope conserved among all four groups of primate immunodeficiency viruses by using monoclonal antibodies. J. Gen. Virol., 73:2721-2724, 1992. Anti-SIVagmTYO-7 Mabs were obtained by intraperitoneal immunization of mice. Two reacted with p17 and three with p24. The anti-p24 MAbs recognized an epitope present in SIVagmTYO-7, SIVagmTYO-5, and HIV-2/SIVmac. The anti-p17 recognized an epitope present in SIVagmTYO-7, SIVagmTYO-5, HIV-2/SIVmac, SIVagmTYO-1, HIV-1, and SIVmnd. This study shows that the matrix protein expresses at least one highly conserved epitope. PubMed ID: 1383399. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 190

Download this epitope record as JSON.

MAb ID 1C4
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 191

Download this epitope record as JSON.

MAb ID 2C11
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 192

Download this epitope record as JSON.

MAb ID 2E3
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

Ovod1992 V. Ovod, A. Lagerstedt, A. Ranki, F. O. Gombert, R. Spohn, M. Tahtinen, G. Jung, and K. J. Krohn. Immunological Variation and Immunohistochemical Localization of HIV-1 Nef Demonstrated with Monoclonal Antibodies. AIDS, 6:25-34, 1992. Ten anti-Nef MAbs were generated and mapped. Nef is expressed in two isomorphic forms, and was shown to be expressed mainly in the Golgi complex and at the nuclear membrane, but occasionally x in the nucleus, particularly in MT-4 cells. PubMed ID: 1371924. Show all entries for this paper.


Displaying record number 194

Download this epitope record as JSON.

MAb ID 3F9
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 195

Download this epitope record as JSON.

MAb ID 5F8
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 196

Download this epitope record as JSON.

MAb ID 6G5
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 197

Download this epitope record as JSON.

MAb ID 7B6
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 198

Download this epitope record as JSON.

MAb ID 7C6
HXB2 Location Pol(716-731)
DNA(4230..4277)
Pol Epitope Map
Author Location Integrase(1-16 HXB2)
Epitope FLDGIDKAQDEHEKYH Epitope Alignment
FLDGIDKAQDEHEKYH epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 199

Download this epitope record as JSON.

MAb ID 6C5
HXB2 Location Pol(732-753)
DNA(4278..4343)
Pol Epitope Map
Author Location Integrase(17-38 HXB2)
Epitope SNWRAMASDFNLPPVVAKEIVA Epitope Alignment
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 200

Download this epitope record as JSON.

MAb ID 8G4
HXB2 Location Pol(737-746 + 797-816)
DNA(4293..4322,4473..4532)
Pol Epitope Map
Author Location Integrase(12-42 HXB2)
Epitope MASDFNLPPV + GYIEAEVIPAETGQETAYFI ? (Discontinuous epitope) Epitope Alignment
MASDFNLPPV + GYIEAEVIPAETGQETAYFI ? epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 201

Download this epitope record as JSON.

MAb ID 4D6
HXB2 Location Pol(757-770)
DNA(4353..4394)
Pol Epitope Map
Author Location Integrase(42-55 HXB2)
Epitope KCQLKGEAMHGQVD Epitope Alignment
KCQLKGEAMHGQVD epitope logo
Subtype B
Ab Type N-term
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 3 of 3 notes.

References

Showing 3 of 3 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

Kanduc2008 Darja Kanduc, Rosario Serpico, Alberta Lucchese, and Yehuda Shoenfeld. Correlating Low-Similarity Peptide Sequences and HIV B-Cell Epitopes. Autoimmun. Rev., 7(4):291-296, Feb 2008. PubMed ID: 18295732. Show all entries for this paper.


Displaying record number 202

Download this epitope record as JSON.

MAb ID 4F6
HXB2 Location Pol(771-817)
DNA(4395..4535)
Pol Epitope Map
Author Location Integrase(56-102 HXB2)
Epitope CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLL Epitope Alignment
Subtype B
Ab Type Integrase catalytic core
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 212

Download this epitope record as JSON.

MAb ID 7F11
HXB2 Location Pol(977-986)
DNA(5013..5042)
Pol Epitope Map
Author Location Integrase(262-271 HXB2)
Epitope RRKAKIIRDY Epitope Alignment
RRKAKIIRDY epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 210

Download this epitope record as JSON.

MAb ID 8E5
HXB2 Location Pol(977-986)
DNA(5013..5042)
Pol Epitope Map
Author Location Integrase(262-271 HXB2)
Epitope RRKAKIIRDY Epitope Alignment
RRKAKIIRDY epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 211

Download this epitope record as JSON.

MAb ID 7C3
HXB2 Location Pol(977-986)
DNA(5013..5042)
Pol Epitope Map
Author Location Integrase(262-271 HXB2)
Epitope RRKAKIIRDY Epitope Alignment
RRKAKIIRDY epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Displaying record number 203

Download this epitope record as JSON.

MAb ID 5D9
HXB2 Location Pol
DNA(4785..4979)
Pol Epitope Map
Author Location Integrase(186-250 HXB2)
Epitope (Discontinuous epitope)
Subtype B
Ab Type Integrase DNA binding domain
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade HXB2
Vaccine component Int

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health