HIV molecular immunology database

 

Search Antibody Database

Found 2 matching records:

Displaying record number 800

Download this epitope record as JSON.

MAb ID 9-11
HXB2 Location gp160(579-604)
DNA(7959..8036)
gp160 Epitope Map
Author Location gp41(584-609)
Epitope RILAVERYLKDQQLLGIWGCSGKLIC Epitope Alignment
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component gp160

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Mani1994 J.-C. Mani, V. Marchi, and C. Cucurou. Effect of HIV-1 Peptide Presentation on the Affinity Constants of Two Monoclonal Antibodies Determined by BIAcore Technology. Mol. Immunol., 31:439-444, 1994. Two MAbs are described; one 41-1 did not require the Cys-Cys disulfide bridge and loop formation, the other 9-11 depends on loop formation. PubMed ID: 7514268. Show all entries for this paper.


Displaying record number 799

Download this epitope record as JSON.

MAb ID 41-1 (41.1, gp41-1)
HXB2 Location gp160(579-608)
DNA(7959..8048)
gp160 Epitope Map
Author Location gp41(584-609 LAV)
Epitope RILAVERYLKDQQLLGIWGCSGKLICTTAV Epitope Alignment
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords antibody binding site, antibody generation

Vaccine Details

Vaccine type protein
Vaccine component gp160

Notes

Showing 7 of 7 notes.

References

Showing 7 of 7 references.

Isolation Paper
Gosting1987 L. H. Gosting, J. McClure, E. S. Dickinson, S. M. Watanabe, K. Shriver, and L. C. Goldstein. Monoclonal antibodies to gp110 and gp41 of human immunodeficiency virus. J. Clin. Microbiol., 25:845-848, 1987. PubMed ID: 2438302. Show all entries for this paper.

Thomas1988 E. Kinney Thomas, J. N. Weber, J. McClure, P. R. Clapham, M. C. Singhal, M. K. Shriver, and R. A. Weiss. Neutralizing Monoclonal Antibodies to the AIDS Virus. AIDS, 2:25-29, 1988. PubMed ID: 2451922. Show all entries for this paper.

Mani1994 J.-C. Mani, V. Marchi, and C. Cucurou. Effect of HIV-1 Peptide Presentation on the Affinity Constants of Two Monoclonal Antibodies Determined by BIAcore Technology. Mol. Immunol., 31:439-444, 1994. Two MAbs are described; one 41-1 did not require the Cys-Cys disulfide bridge and loop formation, the other 9-11 depends on loop formation. PubMed ID: 7514268. Show all entries for this paper.

Pincus1991 S. H. Pincus, R. L. Cole, E. M. Hersh, D. Lake, Y. Masuho, P. J. Durda, and J. McClure. In Vitro Efficacy of Anti-HIV Immunotoxins Targeted by Various Antibodies to the Envelope Protein. J. Immunol., 146:4315-4324, 1991. Six MAbs, (907, 924, 110.1, 41.1, 86 and P5-3) and polyclonal pooled serum antibodies purified on gp160 were coupled to RAC to create immunotoxins. Only 41.1-RAC, an anti-gp41 MAb-immunotoxin and the polyclonal immunotoxin showed direct activity against multiple strains, and activity of an immunotoxin was found not to be directly correlated with cell surface binding. PubMed ID: 1710247. Show all entries for this paper.

Pincus1993 S. H. Pincus and J. McClure. Soluble CD4 Enhances the Efficacy of Immunotoxins Directed against gp41 of the Human Immunodeficiency Virus. Proc. Natl. Acad. Sci. U.S.A., 90:332-336, 1993. PubMed ID: 8419938. Show all entries for this paper.

Pincus1996 S. H. Pincus, K. Wehrly, R. Cole, H. Fang, G. K. Lewis, J. McClure, A. J. Conley, B. Wahren, M. R. Posner, A. L. Notkins, S. A. Tilley, A. Pinter, L. Eiden, M. Teintze, D. Dorward, and V. V. Tolstikov. In Vitro Effects of Anti-HIV Immunotoxins Directed against Multiple Epitopes on HIV Type 1 Envelope Glycoprotein 160. AIDS Res. Hum. Retroviruses, 12:1041-1051, 1996. A panel of anti-gp160 MAbs to was used to construct anti-HIV immunotoxins by coupling antibodies to ricin A chain (RAC). The ability of the immunotoxins to kill HIV-1-infected cells was tested in tissue culture. Immunotoxins that bind epitopes on the cell surface killed infected cells, although killing was not directly proportional to binding. The activity of anti-gp41 immunotoxins was markedly enhanced in the presence of sCD4. PubMed ID: 8827220. Show all entries for this paper.

Pincus1998 S. H. Pincus, R. L. Cole, R. Watson-McKown, A. Pinter, W. Honnen, B. Cole, and K. S. Wise. Immunologic Cross-Reaction between HIV Type 1 p17 and Mycoplasma hyorhinis Variable Lipoprotein. AIDS Res. Hum. Retroviruses, 14:419-425, 1998. PubMed ID: 9546801. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health