HIV molecular immunology database

 

Search Antibody Database

Found 14 matching records:

Displaying record number 25

Download this epitope record as JSON.

MAb ID C5126
HXB2 Location Gag(113-122)
DNA(1126..1155)
Gag Epitope Map
Author Location p17(113-122 HXB2)
Epitope KKAQQAAADT Epitope Alignment
KKAQQAAADT epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type viral lysate
Vaccine component HIV-1

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 87

Download this epitope record as JSON.

MAb ID C5123
HXB2 Location Gag(203-217)
DNA(1396..1440)
Gag Epitope Map
Author Location p24(203-217 HXB2)
Epitope ETINEEAAEWDRVHP Epitope Alignment
ETINEEAAEWDRVHP epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type viral lysate
Vaccine component HIV-1

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 93

Download this epitope record as JSON.

MAb ID FF1
HXB2 Location Gag(208-222)
DNA(1411..1455)
Gag Epitope Map
Author Location p24(208-222 HXB2)
Epitope EAAEWDRVHPVHAGP Epitope Alignment
EAAEWDRVHPVHAGP epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type inactivated HIV

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 97

Download this epitope record as JSON.

MAb ID 38:9.6K (38:96K)
HXB2 Location Gag(253-262)
DNA(1546..1575)
Gag Epitope Map
Author Location p24(253-262 HXB2)
Epitope NPPIPVGEIY Epitope Alignment
NPPIPVGEIY epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 99

Download this epitope record as JSON.

MAb ID EF7
HXB2 Location Gag(273-302)
DNA(1606..1695)
Gag Epitope Map
Author Location p24(273-302 HXB2)
Epitope IVRMYSPTSILDIRQGPKEPFRDYVDRFYK Epitope Alignment
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 3 of 3 notes.

References

Showing 2 of 2 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.

Lundin1996 K. Lundin, A. Samuelsson, M. Jansson, J. Hinkula J, B. Wahren, H. Wigzell, and M. A. Persson. Peptides Isolated from Random Peptide Libraries on Phage Elicit a Neutralizing anti-HIV-1 Response: Analysis of Immunological Mimicry. Immunology, 89:579-586, 1996. PubMed ID: 9014825. Show all entries for this paper.


Displaying record number 100

Download this epitope record as JSON.

MAb ID 30:3E5
HXB2 Location Gag(273-302)
DNA(1606..1695)
Gag Epitope Map
Author Location p24(273-302 HXB2)
Research Contact B. Wahren
Epitope IVRMYSPTSILDIRQGPKEPFRDYVDRFYK Epitope Alignment
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1λ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 111

Download this epitope record as JSON.

MAb ID C5122
HXB2 Location Gag(293-302)
DNA(1666..1695)
Gag Epitope Map
Author Location p24(293-302 HXB2)
Epitope FRDYVDRFYK Epitope Alignment
FRDYVDRFYK epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type viral lysate
Vaccine component HIV-1

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 115

Download this epitope record as JSON.

MAb ID BE3
HXB2 Location Gag(308-322)
DNA(1711..1755)
Gag Epitope Map
Author Location p24(308-322 HXB2)
Research Contact B. Wahren
Epitope QASQEVKNWMTETLL Epitope Alignment
QASQEVKNWMTETLL epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 116

Download this epitope record as JSON.

MAb ID L14
HXB2 Location Gag(308-322)
DNA(1711..1755)
Gag Epitope Map
Author Location p24(308-322 HXB2)
Research Contact B. Wahren
Epitope QASQEVKNWMTETLL Epitope Alignment
QASQEVKNWMTETLL epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 119

Download this epitope record as JSON.

MAb ID 32:32K
HXB2 Location Gag(331-354)
DNA(1780..1851)
Gag Epitope Map
Author Location p24(331-354 HXB2)
Epitope KTILKALGPAATLEEMMTACQGVG Epitope Alignment
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1λ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 120

Download this epitope record as JSON.

MAb ID C5200
HXB2 Location Gag(331-354)
DNA(1780..1851)
Gag Epitope Map
Author Location p24(331-354 HXB2)
Epitope KTILKALGPAATLEEMMTACQGVG Epitope Alignment
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type viral lysate

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 121

Download this epitope record as JSON.

MAb ID FH2
HXB2 Location Gag(333-347)
DNA(1786..1830)
Gag Epitope Map
Author Location p24(333-347 HXB2)
Epitope ILKALGPAATLEEMM Epitope Alignment
ILKALGPAATLEEMM epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Displaying record number 157

Download this epitope record as JSON.

MAb ID EC6
HXB2 Location Gag(408-417)
DNA(2011..2040)
Gag Epitope Map
Author Location p15(408-417 HXB2)
Epitope PRKKGCWKCG Epitope Alignment
PRKKGCWKCG epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG2aκ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.

Kanduc2008 Darja Kanduc, Rosario Serpico, Alberta Lucchese, and Yehuda Shoenfeld. Correlating Low-Similarity Peptide Sequences and HIV B-Cell Epitopes. Autoimmun. Rev., 7(4):291-296, Feb 2008. PubMed ID: 18295732. Show all entries for this paper.


Displaying record number 158

Download this epitope record as JSON.

MAb ID M12
HXB2 Location Gag(408-417)
DNA(2011..2040)
Gag Epitope Map
Author Location p15(408-417 HXB2)
Epitope PRKKGCWKCG Epitope Alignment
PRKKGCWKCG epitope logo
Subtype B
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine component p24-p15 Gag

Notes

Showing 2 of 2 notes.

References

Showing 1 of 1 references.

Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health