Search Antibody Database

Found 9 matching records:

Displaying record number 190

Download this epitope record as JSON.

MAb ID	1C4
HXB2 Location	Pol(716-731) DNA(4230..4277)	Pol Epitope Map
Author Location	Integrase(1-16 HXB2)
Epitope	FLDGIDKAQDEHEKYH	Epitope Alignment
Subtype	B
Ab Type	N-term
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 1C4: One of a large set of MAbs that interact with the N-terminal part of integrase: 1C4, 2C11, 2E3, 3E11, 3F9, 5F8, 6G5, 7B6, 7C6 -- these MAbs inhibit end processing and DNA joining, but had little effect on integration activities. Nilsen1996
• 1C4: MAb interferes with integrase binding to DNA. Haugan1995

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---

Displaying record number 195

Download this epitope record as JSON.

MAb ID	5F8
HXB2 Location	Pol(716-731) DNA(4230..4277)	Pol Epitope Map
Author Location	Integrase(1-16 HXB2)
Epitope	FLDGIDKAQDEHEKYH	Epitope Alignment
Subtype	B
Ab Type	N-term
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 5F8: One of a large set of MAbs that interact with the N-terminal part of integrase: 1C4, 2C11, 2E3, 3E11, 3F9, 5F8, 6G5, 7B6, 7C6 -- these MAbs inhibit end processing and DNA joining, but had little effect on integration activities. Nilsen1996
• 5F8: MAb interferes with integrase binding to DNA. Haugan1995

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---

Displaying record number 199

Download this epitope record as JSON.

MAb ID	6C5
HXB2 Location	Pol(732-753) DNA(4278..4343)	Pol Epitope Map
Author Location	Integrase(17-38 HXB2)
Epitope	SNWRAMASDFNLPPVVAKEIVA	Epitope Alignment
Subtype	B
Ab Type	N-term
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 6C5: This MAb inhibits end processing and DNA joining, but had little effect on integration activities. Nilsen1996
• 6C5: MAb interferes with integrase binding to DNA. Haugan1995

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---

Displaying record number 200

Download this epitope record as JSON.

MAb ID	8G4
HXB2 Location	Pol(737-746 + 797-816) DNA(4293..4322,4473..4532)	Pol Epitope Map
Author Location	Integrase(12-42 HXB2)
Epitope	MASDFNLPPV + GYIEAEVIPAETGQETAYFI ? (Discontinuous epitope)	Epitope Alignment
Subtype	B
Ab Type
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 8G4: MAb interferes with integrase binding to DNA. Haugan1995
• 8G4: This MAb reacted strongly with peptides IN(12-31) and IN(22-42), and less strongly with peptide IN(82-101) -- it did not react with a deletion mutant of positions 17-38 -- this MAb inhibits end processing and DNA joining, but had little effect on integration activities. Nilsen1996

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---

Displaying record number 201

Download this epitope record as JSON.

MAb ID	4D6
HXB2 Location	Pol(757-770) DNA(4353..4394)	Pol Epitope Map
Author Location	Integrase(42-55 HXB2)
Epitope	KCQLKGEAMHGQVD	Epitope Alignment
Subtype	B
Ab Type	N-term
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 3 of 3 notes.

• 4D6: Similarity level of the 4D6 binding site pentapeptide AMHGQ to the host proteome was low, with the low-similarity 5-mer occurring in the host proteome 0 times, indicating that this peptide can be used to elicit Abs for active/passive immunotherapy with low risk of cross-reaction with the host proteome. Kanduc2008
• 4D6: This MAb inhibits end processing and DNA joining, and reduces reintegration activity. Nilsen1996
• 4D6: MAb interferes with integrase binding to DNA. Haugan1995

References

Showing 3 of 3 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

Kanduc2008 Darja Kanduc, Rosario Serpico, Alberta Lucchese, and Yehuda Shoenfeld. Correlating Low-Similarity Peptide Sequences and HIV B-Cell Epitopes. Autoimmun. Rev., 7(4):291-296, Feb 2008. PubMed ID: 18295732. Show all entries for this paper.

---

Displaying record number 202

Download this epitope record as JSON.

MAb ID	4F6
HXB2 Location	Pol(771-817) DNA(4395..4535)	Pol Epitope Map
Author Location	Integrase(56-102 HXB2)
Epitope	CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLL	Epitope Alignment
Subtype	B
Ab Type	Integrase catalytic core
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 4F6: MAb interferes with integrase binding to DNA. Haugan1995
• 4F6: MAb binding had minimal effects on IN in vitro activities. Nilsen1996

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---

Displaying record number 210

Download this epitope record as JSON.

MAb ID	8E5
HXB2 Location	Pol(977-986) DNA(5013..5042)	Pol Epitope Map
Author Location	Integrase(262-271 HXB2)
Epitope	RRKAKIIRDY	Epitope Alignment
Subtype	B
Ab Type
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 8E5: A set of three MAbs recognize an epitope in this region, 7C3, 7F11, and 8E5 -- all three HIV-1 MAbs cross-react with HIV-2 IN -- these MAbs inhibit end-processing, DNA joining and reintegration, and had little effect on disintegration. Nilsen1996
• 8E5: MAb interferes with integrase binding to DNA. Haugan1995

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---

Displaying record number 211

Download this epitope record as JSON.

MAb ID	7C3
HXB2 Location	Pol(977-986) DNA(5013..5042)	Pol Epitope Map
Author Location	Integrase(262-271 HXB2)
Epitope	RRKAKIIRDY	Epitope Alignment
Subtype	B
Ab Type
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 7C3: A set of three MAbs recognize an epitope in this region, 7C3, 7F11, and 8E5 -- all three HIV-1 MAbs cross-react with HIV-2 IN -- these MAbs inhibit end-processing, DNA joining and reintegration, and had little effect on disintegration. Nilsen1996
• 7C3: MAb interferes with integrase binding to DNA. Haugan1995

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---

Displaying record number 203

Download this epitope record as JSON.

MAb ID	5D9
HXB2 Location	Pol DNA(4785..4979)	Pol Epitope Map
Author Location	Integrase(186-250 HXB2)
Epitope	(Discontinuous epitope)
Subtype	B
Ab Type	Integrase DNA binding domain
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	protein
Vaccine strain	B clade HXB2
Vaccine component	Int

Notes

Showing 2 of 2 notes.

• 5D9: While C-term and N-term anti-Integrase MAbs interfere with Integrase-DNA binding, 5D9 which binds more centrally, does not. Haugan1995
• 5D9: MAb binding had minimal effects on IN in vitro activities. Nilsen1996

References

Showing 2 of 2 references.

Haugan1995 I. R. Haugan, B. M. Nilsen, S. Worland, L. Olsen, and D. E. Helland. Characterization of the DNA-Binding Activity of HIV-1 Integrase Using a Filter Binding Assay. Biochem. Biophys. Res. Commun., 217:802-810, 1995. PubMed ID: 8554601. Show all entries for this paper.

Nilsen1996 B. M. Nilsen, I. R. Haugan, K. Berg, L. Olsen, P. O. Brown, and D. E. Helland. Monoclonal Antibodies against Human Immunodeficiency Virus Type 1 Integrase: Epitope Mapping and Differential Effects of Integrase Activities In Vitro. J. Virol., 70:1580-1587, 1996. In this study, 17 anti-integrase murine Mabs were generated and epitopes were mapped by deletion mutations and peptide scanning. The ability of MAb binding to inhibit (or stimulate) end-processing, DNA joining, reintegration, and disintegration enzyme functions it in vitro was determined. PubMed ID: 8627677. Show all entries for this paper.

---