HIV molecular immunology database
Found 12 matching records:
Download this epitope record as JSON.
MAb ID | D/3G5 | |
---|---|---|
HXB2 Location | gp160(73-82) DNA(6441..6470) |
gp160 Epitope Map |
Author Location | gp120(73-82 LAI) | |
Epitope |
ACVPTDPNPQ
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse(IgG1) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | D/6A11 | |
---|---|---|
HXB2 Location | gp160(73-82) DNA(6441..6470) |
gp160 Epitope Map |
Author Location | gp120(73-82 LAI) | |
Epitope |
ACVPTDPNPQ
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Kanduc2008 Darja Kanduc, Rosario Serpico, Alberta Lucchese, and Yehuda Shoenfeld. Correlating Low-Similarity Peptide Sequences and HIV B-Cell Epitopes. Autoimmun. Rev., 7(4):291-296, Feb 2008. PubMed ID: 18295732. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | D/5E12 | |
---|---|---|
HXB2 Location | gp160(73-92) DNA(6441..6500) |
gp160 Epitope Map |
Author Location | gp120(73-92 LAI) | |
Epitope |
ACVPTDPNPQEVVLVNVTEN
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | B242 | |
---|---|---|
HXB2 Location | gp160(83-92) DNA(6471..6500) |
gp160 Epitope Map |
Author Location | gp120(83-92 LAI) | |
Epitope |
EVVLVNVTEN
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse(IgG1) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade NL43 |
Vaccine component | gp160 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | B27 | |
---|---|---|
HXB2 Location | gp160(93-96) DNA(6501..6512) |
gp160 Epitope Map |
Author Location | gp120(94-97 BH10) | |
Epitope |
FNMW
|
Epitope Alignment
|
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse(IgG1) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade NL43 |
Vaccine component | gp160 |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Abacioglu1994 Y. H. Abacioglu, T. R. Fouts, J. D. Laman, E. Claassen, S. H. Pincus, J. P. Moore, C. A. Roby, R. Kamin-Lewis, and G. K. Lewis. Epitope Mapping and Topology of Baculovirus-Expressed HIV-1 gp160 Determined with a Panel of Murine Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 10:371-381, 1994. Thirty MAbs were obtained from BALB/c mice immunized with rgp160 LAI expressed in baculovirus. These antibodies map to 4 domains: gp120 C1, C2, C3/V4, and the cytoplasmic tail of gp41. All epitopes were exposed on rgp160 without denaturing the protein, but 6/8 epitopes mapped in gp120 are not exposed unless the protein is denatured, showing rgp160 and rgp120 fold differently. PubMed ID: 8068416. Show all entries for this paper.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | D/5A11 | |
---|---|---|
HXB2 Location | gp160(93-101) DNA(6501..6527) |
gp160 Epitope Map |
Author Location | gp120(93-101 LAI) | |
Epitope |
FNMWKNDMV
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | D/4B5 | |
---|---|---|
HXB2 Location | gp160(93-101) DNA(6501..6527) |
gp160 Epitope Map |
Author Location | gp120(93-101 LAI) | |
Epitope |
FNMWKNDMV
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Kanduc2008 Darja Kanduc, Rosario Serpico, Alberta Lucchese, and Yehuda Shoenfeld. Correlating Low-Similarity Peptide Sequences and HIV B-Cell Epitopes. Autoimmun. Rev., 7(4):291-296, Feb 2008. PubMed ID: 18295732. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | D/6B2 | |
---|---|---|
HXB2 Location | gp160(93-101) DNA(6501..6527) |
gp160 Epitope Map |
Author Location | gp120(93-101 LAI) | |
Epitope |
FNMWKNDMV
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C1 | |
Neutralizing | ||
Species (Isotype) | mouse(IgG1) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | B33 | |
---|---|---|
HXB2 Location | gp160(123-142) DNA(6591..6650) |
gp160 Epitope Map |
Author Location | gp120(123-142 LAI) | |
Research Contact | Daniels | |
Epitope |
TPLCVSLKCTDLGNATNTNS
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 V2 // V2 glycan(V2g) // V2 apex | |
Neutralizing | ||
Species (Isotype) | mouse(IgG2bκ) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade NL43 |
Vaccine component | gp160 |
Showing 4 of 4 notes.
Showing 2 of 2 references.
Abacioglu1994 Y. H. Abacioglu, T. R. Fouts, J. D. Laman, E. Claassen, S. H. Pincus, J. P. Moore, C. A. Roby, R. Kamin-Lewis, and G. K. Lewis. Epitope Mapping and Topology of Baculovirus-Expressed HIV-1 gp160 Determined with a Panel of Murine Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 10:371-381, 1994. Thirty MAbs were obtained from BALB/c mice immunized with rgp160 LAI expressed in baculovirus. These antibodies map to 4 domains: gp120 C1, C2, C3/V4, and the cytoplasmic tail of gp41. All epitopes were exposed on rgp160 without denaturing the protein, but 6/8 epitopes mapped in gp120 are not exposed unless the protein is denatured, showing rgp160 and rgp120 fold differently. PubMed ID: 8068416. Show all entries for this paper.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | D/6D1 | |
---|---|---|
HXB2 Location | gp160(346-377) DNA(7260..7355) |
gp160 Epitope Map |
Author Location | gp120(351-382 LAI) | |
Epitope |
ASKLREQFGNNKTIIFKQSSGGDPEIVTHSFN
|
Epitope Alignment |
Subtype | B | |
Ab Type | gp120 V4 | |
Neutralizing | ||
Species (Isotype) | mouse(IgG1) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | B221 (221) | |
---|---|---|
HXB2 Location | gp160(471-490) DNA(7635..7694) |
gp160 Epitope Map |
Author Location | gp120(471-490 LAI) | |
Research Contact | Rod Daniels | |
Epitope |
GGGDMRDNWRSELYKYKVVK
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp120 C5 | |
Neutralizing | ||
Species (Isotype) | mouse(IgG1κ) | |
Patient | ||
Immunogen | vaccine | |
Keywords | antibody interactions, dendritic cells, neutralization |
Vaccine type | protein |
---|---|
Vaccine strain | B clade NL43 |
Vaccine component | gp160 |
Showing 8 of 8 notes.
Showing 7 of 7 references.
Moore1993a J. P. Moore and D. D. Ho. Antibodies to discontinuous or conformationally sensitive epitopes on the gp120 glycoprotein of human immunodeficiency virus type 1 are highly prevalent in sera of infected humans. J. Virol., 67:863-875, 1993. CD4BS antibodies are prevalent in HIV-1-positive sera, while neutralizing MAbs to C4, V2, and V3 and MAbs to linear epitopes are less common. Most linear epitope MAbs in human sera are directed against the V3 region, and cross-reactive MAbs tend to be directed against discontinuous epitopes. PubMed ID: 7678308. Show all entries for this paper.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.
Moore1994a J. P. Moore, Q. J. Sattentau, R. Wyatt, and J. Sodroski. Probing the Structure of the Human Immunodeficiency Virus Surface Glycoprotein gp120 with a Panel of Monoclonal Antibodies. J. Virol., 68:469-484, 1994. This study compared a large number of MAbs that bind to linear epitopes of gp120, and compared binding affinities for: i) native and SDS-DDT denatured gp120, (clone BH10 of the LAI isolate expressed in CHO cells); ii) recombinant gp120 lacking the V1, V2, V3 loops; iii) a panel of 20 mer peptides; iv) a panel of gp120 mutants; and v) oligomeric versus monomeric gp120. The binding ratio of native versus denatured monomeric gp120 is included in the table in this database. These numbers should be considered with the following points in mind: a continuous epitope may be partially exposed on the surface; and a preparation of rgp120 is not homogeneous and contains fully folded, partly denatured, and some completely unfolded species, so the conformation of what is considered to be a native protein will not only reflect fully folded gp120. The authors suggest that a fivefold increase in the affinity for a MAb binding to denatured versus native gp120 indicates that the epitope is inaccessible in the native form. We also have included here information extracted from Moore et al's list of the gp120 mutations that reduced the binding of a particular MAb. In mapping of exposed regions of gp120, C2, C3, and C5 domain epitopes were found to bind preferentially to denatured gp120. V1, V2 and V3, part of C4, and the extreme carboxy terminus of C5 were exposed on the native monomer. In the oligomeric form of the molecule, only V2, V3 and part of C4 are well exposed as continuous epitopes. PubMed ID: 7504741. Show all entries for this paper.
Moore1994c J. P. Moore, R. L. Willey, G. K. Lewis, J. Robinson, and J. Sodroski. Immunological evidence for interactions between the first, second and fifth conserved domains of the gp120 surface glycoprotein of human immunodeficiency virus type 1. J. Virol., 68:6836-6847, 1994. Mutation 267N/Q in C2 region results in exposing the carboxy-terminal end gp120. PubMed ID: 7933065. Show all entries for this paper.
Holl2006 Vincent Holl, Maryse Peressin, Thomas Decoville, Sylvie Schmidt, Susan Zolla-Pazner, Anne-Marie Aubertin, and Christiane Moog. Nonneutralizing Antibodies Are Able To Inhibit Human Immunodeficiency Virus Type 1 Replication in Macrophages and Immature Dendritic Cells. J. Virol., 80(12):6177-6181, Jun 2006. PubMed ID: 16731957. Show all entries for this paper.
Billington2007 J. Billington, T. P. Hickling, G. H. Munro, C. Halai, R. Chung, G. G. Dodson, and R. S. Daniels. Stability of a Receptor-Binding Active Human Immunodeficiency Virus Type 1 Recombinant gp140 Trimer Conferred by Intermonomer Disulfide Bonding of the V3 Loop: Differential Effects of Protein Disulfide Isomerase on CD4 and Coreceptor Binding. J. Virol., 81(9):4604-4614, May 2007. PubMed ID: 17301129. Show all entries for this paper.
Vincent2012 Nadine Vincent and Etienne Malvoisin. Ability of Antibodies Specific to the HIV-1 Envelope Glycoprotein to Block the Fusion Inhibitor T20 in a Cell-Cell Fusion Assay. Immunobiology, 217(10):943-950, Oct 2012. PubMed ID: 22387075. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | B33 | |
---|---|---|
HXB2 Location | gp160(727-734) DNA(8403..8426) |
gp160 Epitope Map |
Author Location | gp41(727-734 BH10) | |
Epitope |
PDRPEGIE
|
Epitope Alignment
|
Ab Type | ||
Neutralizing | ||
Species (Isotype) | mouse(IgG1) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade NL43 |
Vaccine component | gp160 |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Bristow1994
R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249.
Show all entries for this paper.
Abacioglu1994 Y. H. Abacioglu, T. R. Fouts, J. D. Laman, E. Claassen, S. H. Pincus, J. P. Moore, C. A. Roby, R. Kamin-Lewis, and G. K. Lewis. Epitope Mapping and Topology of Baculovirus-Expressed HIV-1 gp160 Determined with a Panel of Murine Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 10:371-381, 1994. Thirty MAbs were obtained from BALB/c mice immunized with rgp160 LAI expressed in baculovirus. These antibodies map to 4 domains: gp120 C1, C2, C3/V4, and the cytoplasmic tail of gp41. All epitopes were exposed on rgp160 without denaturing the protein, but 6/8 epitopes mapped in gp120 are not exposed unless the protein is denatured, showing rgp160 and rgp120 fold differently. PubMed ID: 8068416. Show all entries for this paper.