HIV molecular immunology database

 

Search Antibody Database

Found 12 matching records:

Displaying record number 264

Download this epitope record as JSON.

MAb ID D/3G5
HXB2 Location gp160(73-82)
DNA(6441..6470)
gp160 Epitope Map
Author Location gp120(73-82 LAI)
Epitope ACVPTDPNPQ Epitope Alignment
ACVPTDPNPQ epitope logo
Subtype B
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade LAI
Vaccine component gp120

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 265

Download this epitope record as JSON.

MAb ID D/6A11
HXB2 Location gp160(73-82)
DNA(6441..6470)
gp160 Epitope Map
Author Location gp120(73-82 LAI)
Epitope ACVPTDPNPQ Epitope Alignment
ACVPTDPNPQ epitope logo
Subtype B
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade LAI
Vaccine component gp120

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.

Kanduc2008 Darja Kanduc, Rosario Serpico, Alberta Lucchese, and Yehuda Shoenfeld. Correlating Low-Similarity Peptide Sequences and HIV B-Cell Epitopes. Autoimmun. Rev., 7(4):291-296, Feb 2008. PubMed ID: 18295732. Show all entries for this paper.


Displaying record number 266

Download this epitope record as JSON.

MAb ID D/5E12
HXB2 Location gp160(73-92)
DNA(6441..6500)
gp160 Epitope Map
Author Location gp120(73-92 LAI)
Epitope ACVPTDPNPQEVVLVNVTEN Epitope Alignment
ACVPTDPNPQEVVLVNVTEN epitope logo
Subtype B
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade LAI
Vaccine component gp120

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 268

Download this epitope record as JSON.

MAb ID B242
HXB2 Location gp160(83-92)
DNA(6471..6500)
gp160 Epitope Map
Author Location gp120(83-92 LAI)
Epitope EVVLVNVTEN Epitope Alignment
EVVLVNVTEN epitope logo
Subtype B
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade NL43
Vaccine component gp160

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 280

Download this epitope record as JSON.

MAb ID B27
HXB2 Location gp160(93-96)
DNA(6501..6512)
gp160 Epitope Map
Author Location gp120(94-97 BH10)
Epitope FNMW Epitope Alignment
FNMW epitope logo
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade NL43
Vaccine component gp160

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Abacioglu1994 Y. H. Abacioglu, T. R. Fouts, J. D. Laman, E. Claassen, S. H. Pincus, J. P. Moore, C. A. Roby, R. Kamin-Lewis, and G. K. Lewis. Epitope Mapping and Topology of Baculovirus-Expressed HIV-1 gp160 Determined with a Panel of Murine Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 10:371-381, 1994. Thirty MAbs were obtained from BALB/c mice immunized with rgp160 LAI expressed in baculovirus. These antibodies map to 4 domains: gp120 C1, C2, C3/V4, and the cytoplasmic tail of gp41. All epitopes were exposed on rgp160 without denaturing the protein, but 6/8 epitopes mapped in gp120 are not exposed unless the protein is denatured, showing rgp160 and rgp120 fold differently. PubMed ID: 8068416. Show all entries for this paper.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 276

Download this epitope record as JSON.

MAb ID D/5A11
HXB2 Location gp160(93-101)
DNA(6501..6527)
gp160 Epitope Map
Author Location gp120(93-101 LAI)
Epitope FNMWKNDMV Epitope Alignment
FNMWKNDMV epitope logo
Subtype B
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade LAI
Vaccine component gp120

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 274

Download this epitope record as JSON.

MAb ID D/4B5
HXB2 Location gp160(93-101)
DNA(6501..6527)
gp160 Epitope Map
Author Location gp120(93-101 LAI)
Epitope FNMWKNDMV Epitope Alignment
FNMWKNDMV epitope logo
Subtype B
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade LAI
Vaccine component gp120

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.

Kanduc2008 Darja Kanduc, Rosario Serpico, Alberta Lucchese, and Yehuda Shoenfeld. Correlating Low-Similarity Peptide Sequences and HIV B-Cell Epitopes. Autoimmun. Rev., 7(4):291-296, Feb 2008. PubMed ID: 18295732. Show all entries for this paper.


Displaying record number 275

Download this epitope record as JSON.

MAb ID D/6B2
HXB2 Location gp160(93-101)
DNA(6501..6527)
gp160 Epitope Map
Author Location gp120(93-101 LAI)
Epitope FNMWKNDMV Epitope Alignment
FNMWKNDMV epitope logo
Subtype B
Ab Type gp120 C1
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade LAI
Vaccine component gp120

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 311

Download this epitope record as JSON.

MAb ID B33
HXB2 Location gp160(123-142)
DNA(6591..6650)
gp160 Epitope Map
Author Location gp120(123-142 LAI)
Research Contact Daniels
Epitope TPLCVSLKCTDLGNATNTNS Epitope Alignment
TPLCVSLKCTDLGNATNTNS epitope logo
Subtype B
Ab Type gp120 V2 // V2 glycan(V2g) // V2 apex
Neutralizing  
Species (Isotype) mouse(IgG2bκ)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade NL43
Vaccine component gp160

Notes

Showing 4 of 4 notes.

References

Showing 2 of 2 references.

Abacioglu1994 Y. H. Abacioglu, T. R. Fouts, J. D. Laman, E. Claassen, S. H. Pincus, J. P. Moore, C. A. Roby, R. Kamin-Lewis, and G. K. Lewis. Epitope Mapping and Topology of Baculovirus-Expressed HIV-1 gp160 Determined with a Panel of Murine Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 10:371-381, 1994. Thirty MAbs were obtained from BALB/c mice immunized with rgp160 LAI expressed in baculovirus. These antibodies map to 4 domains: gp120 C1, C2, C3/V4, and the cytoplasmic tail of gp41. All epitopes were exposed on rgp160 without denaturing the protein, but 6/8 epitopes mapped in gp120 are not exposed unless the protein is denatured, showing rgp160 and rgp120 fold differently. PubMed ID: 8068416. Show all entries for this paper.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 522

Download this epitope record as JSON.

MAb ID D/6D1
HXB2 Location gp160(346-377)
DNA(7260..7355)
gp160 Epitope Map
Author Location gp120(351-382 LAI)
Epitope ASKLREQFGNNKTIIFKQSSGGDPEIVTHSFN Epitope Alignment
Subtype B
Ab Type gp120 V4
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade LAI
Vaccine component gp120

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.


Displaying record number 568

Download this epitope record as JSON.

MAb ID B221 (221)
HXB2 Location gp160(471-490)
DNA(7635..7694)
gp160 Epitope Map
Author Location gp120(471-490 LAI)
Research Contact Rod Daniels
Epitope GGGDMRDNWRSELYKYKVVK Epitope Alignment
GGGDMRDNWRSELYKYKVVK epitope logo
Subtype B
Ab Type gp120 C5
Neutralizing  
Species (Isotype) mouse(IgG1κ)
Patient  
Immunogen vaccine
Keywords antibody interactions, dendritic cells, neutralization

Vaccine Details

Vaccine type protein
Vaccine strain B clade NL43
Vaccine component gp160

Notes

Showing 8 of 8 notes.

References

Showing 7 of 7 references.

Moore1993a J. P. Moore and D. D. Ho. Antibodies to discontinuous or conformationally sensitive epitopes on the gp120 glycoprotein of human immunodeficiency virus type 1 are highly prevalent in sera of infected humans. J. Virol., 67:863-875, 1993. CD4BS antibodies are prevalent in HIV-1-positive sera, while neutralizing MAbs to C4, V2, and V3 and MAbs to linear epitopes are less common. Most linear epitope MAbs in human sera are directed against the V3 region, and cross-reactive MAbs tend to be directed against discontinuous epitopes. PubMed ID: 7678308. Show all entries for this paper.

Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.

Moore1994a J. P. Moore, Q. J. Sattentau, R. Wyatt, and J. Sodroski. Probing the Structure of the Human Immunodeficiency Virus Surface Glycoprotein gp120 with a Panel of Monoclonal Antibodies. J. Virol., 68:469-484, 1994. This study compared a large number of MAbs that bind to linear epitopes of gp120, and compared binding affinities for: i) native and SDS-DDT denatured gp120, (clone BH10 of the LAI isolate expressed in CHO cells); ii) recombinant gp120 lacking the V1, V2, V3 loops; iii) a panel of 20 mer peptides; iv) a panel of gp120 mutants; and v) oligomeric versus monomeric gp120. The binding ratio of native versus denatured monomeric gp120 is included in the table in this database. These numbers should be considered with the following points in mind: a continuous epitope may be partially exposed on the surface; and a preparation of rgp120 is not homogeneous and contains fully folded, partly denatured, and some completely unfolded species, so the conformation of what is considered to be a native protein will not only reflect fully folded gp120. The authors suggest that a fivefold increase in the affinity for a MAb binding to denatured versus native gp120 indicates that the epitope is inaccessible in the native form. We also have included here information extracted from Moore et al's list of the gp120 mutations that reduced the binding of a particular MAb. In mapping of exposed regions of gp120, C2, C3, and C5 domain epitopes were found to bind preferentially to denatured gp120. V1, V2 and V3, part of C4, and the extreme carboxy terminus of C5 were exposed on the native monomer. In the oligomeric form of the molecule, only V2, V3 and part of C4 are well exposed as continuous epitopes. PubMed ID: 7504741. Show all entries for this paper.

Moore1994c J. P. Moore, R. L. Willey, G. K. Lewis, J. Robinson, and J. Sodroski. Immunological evidence for interactions between the first, second and fifth conserved domains of the gp120 surface glycoprotein of human immunodeficiency virus type 1. J. Virol., 68:6836-6847, 1994. Mutation 267N/Q in C2 region results in exposing the carboxy-terminal end gp120. PubMed ID: 7933065. Show all entries for this paper.

Holl2006 Vincent Holl, Maryse Peressin, Thomas Decoville, Sylvie Schmidt, Susan Zolla-Pazner, Anne-Marie Aubertin, and Christiane Moog. Nonneutralizing Antibodies Are Able To Inhibit Human Immunodeficiency Virus Type 1 Replication in Macrophages and Immature Dendritic Cells. J. Virol., 80(12):6177-6181, Jun 2006. PubMed ID: 16731957. Show all entries for this paper.

Billington2007 J. Billington, T. P. Hickling, G. H. Munro, C. Halai, R. Chung, G. G. Dodson, and R. S. Daniels. Stability of a Receptor-Binding Active Human Immunodeficiency Virus Type 1 Recombinant gp140 Trimer Conferred by Intermonomer Disulfide Bonding of the V3 Loop: Differential Effects of Protein Disulfide Isomerase on CD4 and Coreceptor Binding. J. Virol., 81(9):4604-4614, May 2007. PubMed ID: 17301129. Show all entries for this paper.

Vincent2012 Nadine Vincent and Etienne Malvoisin. Ability of Antibodies Specific to the HIV-1 Envelope Glycoprotein to Block the Fusion Inhibitor T20 in a Cell-Cell Fusion Assay. Immunobiology, 217(10):943-950, Oct 2012. PubMed ID: 22387075. Show all entries for this paper.


Displaying record number 822

Download this epitope record as JSON.

MAb ID B33
HXB2 Location gp160(727-734)
DNA(8403..8426)
gp160 Epitope Map
Author Location gp41(727-734 BH10)
Epitope PDRPEGIE Epitope Alignment
PDRPEGIE epitope logo
Ab Type  
Neutralizing  
Species (Isotype) mouse(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade NL43
Vaccine component gp160

Notes

Showing 2 of 2 notes.

References

Showing 2 of 2 references.

Isolation Paper
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.

Abacioglu1994 Y. H. Abacioglu, T. R. Fouts, J. D. Laman, E. Claassen, S. H. Pincus, J. P. Moore, C. A. Roby, R. Kamin-Lewis, and G. K. Lewis. Epitope Mapping and Topology of Baculovirus-Expressed HIV-1 gp160 Determined with a Panel of Murine Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 10:371-381, 1994. Thirty MAbs were obtained from BALB/c mice immunized with rgp160 LAI expressed in baculovirus. These antibodies map to 4 domains: gp120 C1, C2, C3/V4, and the cytoplasmic tail of gp41. All epitopes were exposed on rgp160 without denaturing the protein, but 6/8 epitopes mapped in gp120 are not exposed unless the protein is denatured, showing rgp160 and rgp120 fold differently. PubMed ID: 8068416. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health