HIV molecular immunology database
Found 31 matching records:
Download this epitope record as JSON.
MAb ID | Fab M8B (M8B) | |
---|---|---|
HXB2 Location | gp160(579-608) DNA(7959..8048) |
gp160 Epitope Map |
Author Location | gp41(584-609 LAI) | |
Epitope |
RILAVERYLKDQQLLGIWGCSGKLICTTAV
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab M26B (M26B) | |
---|---|---|
HXB2 Location | gp160(579-608) DNA(7959..8048) |
gp160 Epitope Map |
Author Location | gp41(584-609 LAI) | |
Epitope |
RILAVERYLKDQQLLGIWGCSGKLICTTAV
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab T2 (T2) | |
---|---|---|
HXB2 Location | gp160(579-608) DNA(7959..8048) |
gp160 Epitope Map |
Author Location | gp41(584-609 LAI) | |
Epitope |
RILAVERYLKDQQLLGIWGCSGKLICTTAV
|
Epitope Alignment |
Subtype | B | |
Ab Type | gp41 cluster I | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, binding affinity, neutralization, review |
Showing 5 of 5 notes.
Showing 5 of 5 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Moore2006 Penny L. Moore, Emma T. Crooks, Lauren Porter, Ping Zhu, Charmagne S. Cayanan, Henry Grise, Paul Corcoran, Michael B. Zwick, Michael Franti, Lynn Morris, Kenneth H. Roux, Dennis R. Burton, and James M. Binley. Nature of Nonfunctional Envelope Proteins on the Surface of Human Immunodeficiency Virus Type 1. J. Virol., 80(5):2515-2528, Mar 2006. PubMed ID: 16474158. Show all entries for this paper.
Crooks2008 Emma T. Crooks, Pengfei Jiang, Michael Franti, Sharon Wong, Michael B. Zwick, James A. Hoxie, James E. Robinson, Penny L. Moore, and James M. Binley. Relationship of HIV-1 and SIV Envelope Glycoprotein Trimer Occupation and Neutralization. Virology, 377(2):364-378, 1 Aug 2008. PubMed ID: 18539308. Show all entries for this paper.
Nelson2008 Josh D. Nelson, Heather Kinkead, Florence M. Brunel, Dan Leaman, Richard Jensen, John M. Louis, Toshiaki Maruyama, Carole A. Bewley, Katherine Bowdish, G. Marius Clore, Philip E. Dawson, Shana Frederickson, Rose G. Mage, Douglas D. Richman, Dennis R. Burton, and Michael B. Zwick. Antibody Elicited against the gp41 N-Heptad Repeat (NHR) Coiled-Coil Can Neutralize HIV-1 with Modest Potency but Non-Neutralizing Antibodies Also Bind to NHR Mimetics. Virology, 377(1):170-183, 20 Jul 2008. PubMed ID: 18499210. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab M12B (M12B) | |
---|---|---|
HXB2 Location | gp160(579-608) DNA(7959..8048) |
gp160 Epitope Map |
Author Location | gp41(584-609 LAI) | |
Epitope |
RILAVERYLKDQQLLGIWGCSGKLICTTAV
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab A1 (A1) | |
---|---|---|
HXB2 Location | gp160(579-608) DNA(7959..8048) |
gp160 Epitope Map |
Author Location | gp41(584-609 LAI) | |
Epitope |
RILAVERYLKDQQLLGIWGCSGKLICTTAV
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | A | |
Immunogen | HIV-1 infection | |
Keywords | anti-idiotype, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab A4 (A4) | |
---|---|---|
HXB2 Location | gp160(579-608) DNA(7959..8048) |
gp160 Epitope Map |
Author Location | gp41(584-609 LAI) | |
Epitope |
RILAVERYLKDQQLLGIWGCSGKLICTTAV
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | A | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | 240-D (240D) | |
---|---|---|
HXB2 Location | gp160(592-600) DNA(7998..8024) |
gp160 Epitope Map |
Author Location | gp41(592-600 HXB2) | |
Research Contact | Susan Zolla-Pazner (Zollas01@mcrcr6.med.nyu), NYU, NY | |
Epitope |
LLGIWGCSG
|
Epitope Alignment
|
Subtype | B | |
Ab Type | gp41 cluster I | |
Neutralizing | no | |
Species (Isotype) | human | |
Patient | ||
Immunogen | HIV-1 infection | |
Keywords | ADCC, antibody binding site, antibody interactions, antibody polyreactivity, antibody sequence, binding affinity, complement, dendritic cells, enhancing activity, kinetics, neutralization, review, structure, subtype comparisons, vaccine antigen design, vaccine-induced immune responses, variant cross-reactivity, viral fitness and reversion |
Showing 24 of 24 notes.
Showing 24 of 24 references.
Isolation Paper
Robinson1991
W. E. Robinson, M. K. Gorny, J.-Y. Xu, W. M. Mitchell, and S. Zolla-Pazner. Two Immunodominant Domains of gp41 Bind Antibodies Which Enhance Human Immunodeficiency Virus Type 1 Infection In Vitro. J. Virol., 65:4169-4176, 1991. PubMed ID: 2072448.
Show all entries for this paper.
Binley1996 J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976. Show all entries for this paper.
Cai2017 Yongfei Cai, Selen Karaca-Griffin, Jia Chen, Sai Tian, Nicholas Fredette, Christine E. Linton, Sophia Rits-Volloch, Jianming Lu, Kshitij Wagh, James Theiler, Bette Korber, Michael S. Seaman, Stephen C. Harrison, Andrea Carfi, and Bing Chen. Antigenicity-Defined Conformations of an Extremely Neutralization-Resistant HIV-1 Envelope Spike. Proc. Natl. Acad. Sci. U.S.A., 114(17):4477-4482, 25 Apr 2017. PubMed ID: 28396421. Show all entries for this paper.
Chen2015 Jia Chen, James M. Kovacs, Hanqin Peng, Sophia Rits-Volloch, Jianming Lu, Donghyun Park, Elise Zablowsky, Michael S. Seaman, and Bing Chen. Effect of the Cytoplasmic Domain on Antigenic Characteristics of HIV-1 Envelope Glycoprotein. Science, 349(6244):191-195, 10 Jul 2015. PubMed ID: 26113642. Show all entries for this paper.
Dennison2011a S. Moses Dennison, Kara Anasti, Richard M. Scearce, Laura Sutherland, Robert Parks, Shi-Mao Xia, Hua-Xin Liao, Miroslaw K. Gorny, Susan Zolla-Pazner, Barton F. Haynes, and S. Munir Alam. Nonneutralizing HIV-1 gp41 Envelope Cluster II Human Monoclonal Antibodies Show Polyreactivity for Binding to Phospholipids and Protein Autoantigens. J. Virol., 85(3):1340-1347, Feb 2011. PubMed ID: 21106741. Show all entries for this paper.
Finnegan2002 Catherine M. Finnegan, Werner Berg, George K. Lewis, and Anthony L. DeVico. Antigenic Properties of the Human Immunodeficiency Virus Transmembrane Glycoprotein during Cell-Cell Fusion. J. Virol., 76(23):12123-12134, Dec 2002. PubMed ID: 12414953. Show all entries for this paper.
Frey2008 Gary Frey, Hanqin Peng, Sophia Rits-Volloch, Marco Morelli, Yifan Cheng, and Bing Chen. A Fusion-Intermediate State of HIV-1 gp41 Targeted by Broadly Neutralizing Antibodies. Proc. Natl. Acad. Sci. U.S.A., 105(10):3739-3744, 11 Mar 2008. PubMed ID: 18322015. Show all entries for this paper.
Frey2010 Gary Frey, Jia Chen, Sophia Rits-Volloch, Michael M. Freeman, Susan Zolla-Pazner, and Bing Chen. Distinct Conformational States of HIV-1 gp41 Are Recognized by Neutralizing and Non-Neutralizing Antibodies. Nat. Struct. Mol. Biol., 17(12):1486-1491, Dec 2010. PubMed ID: 21076402. Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Gorny2009 Miroslaw K. Gorny, Xiao-Hong Wang, Constance Williams, Barbara Volsky, Kathy Revesz, Bradley Witover, Sherri Burda, Mateusz Urbanski, Phillipe Nyambi, Chavdar Krachmarov, Abraham Pinter, Susan Zolla-Pazner, and Arthur Nadas. Preferential Use of the VH5-51 Gene Segment by the Human Immune Response to Code for Antibodies against the V3 Domain of HIV-1. Mol. Immunol., 46(5):917-926, Feb 2009. PubMed ID: 18952295. Show all entries for this paper.
Holl2006 Vincent Holl, Maryse Peressin, Thomas Decoville, Sylvie Schmidt, Susan Zolla-Pazner, Anne-Marie Aubertin, and Christiane Moog. Nonneutralizing Antibodies Are Able To Inhibit Human Immunodeficiency Virus Type 1 Replication in Macrophages and Immature Dendritic Cells. J. Virol., 80(12):6177-6181, Jun 2006. PubMed ID: 16731957. Show all entries for this paper.
Mitchell1998 W. M. Mitchell, L. Ding, and J. Gabriel. Inactivation of a Common Epitope Responsible for the Induction of Antibody-Dependent Enhancement of HIV. AIDS, 12:147-156, 1998. PubMed ID: 9468363. Show all entries for this paper.
Nyambi2000 P. N. Nyambi, H. A. Mbah, S. Burda, C. Williams, M. K. Gorny, A. Nadas, and S. Zolla-Pazner. Conserved and Exposed Epitopes on Intact, Native, Primary Human Immunodeficiency Virus Type 1 Virions of Group M. J. Virol., 74:7096-7107, 2000. PubMed ID: 10888650. Show all entries for this paper.
Perez2009 Lautaro G. Perez, Matthew R. Costa, Christopher A. Todd, Barton F. Haynes, and David C. Montefiori. Utilization of Immunoglobulin G Fc Receptors by Human Immunodeficiency Virus Type 1: A Specific Role for Antibodies against the Membrane-Proximal External Region of gp41. J. Virol., 83(15):7397-7410, Aug 2009. PubMed ID: 19458010. Show all entries for this paper.
Spear1993 G. T. Spear, D. M. Takefman, B. L. Sullivan, A. L. Landay, and S. Zolla-Pazner. Complement activation by human monoclonal antibodies to human immunodeficiency virus. J. Virol., 67:53-59, 1993. This study looked at the ability of 16 human MAbs to activate complement. MAbs directed against the V3 region could induce C3 deposition on infected cells and virolysis of free virus, but antibodies to the CD4BS and C-terminal region and two regions in gp41 could induce no complement mediated effects. Pre-treatment with sCD4 could increase complement-mediated effects of anti-gp41 MAbs, but decreased the complement-mediated effects of V3 MAbs. Anti-gp41 MAbs were able to affect IIIB but not MN virolysis, suggesting spontaneous shedding of gp120 on IIIB virions exposes gp41 epitopes. IgG isotype did not appear to have an effect on virolysis or C3 deposition. PubMed ID: 7677959. Show all entries for this paper.
Vincent2008 Nadine Vincent, Amadou Kone, Blandine Chanut, Frédéric Lucht, Christian Genin, and Etienne Malvoisin. Antibodies Purified from Sera of HIV-1-Infected Patients by Affinity on the Heptad Repeat Region 1/Heptad Repeat Region 2 Complex of gp41 Neutralize HIV-1 Primary Isolates. AIDS, 22(16):2075-2085, 18 Oct 2008. PubMed ID: 18832871. Show all entries for this paper.
Vincent2012 Nadine Vincent and Etienne Malvoisin. Ability of Antibodies Specific to the HIV-1 Envelope Glycoprotein to Block the Fusion Inhibitor T20 in a Cell-Cell Fusion Assay. Immunobiology, 217(10):943-950, Oct 2012. PubMed ID: 22387075. Show all entries for this paper.
vonBredow2016 Benjamin von Bredow, Juan F. Arias, Lisa N. Heyer, Brian Moldt, Khoa Le, James E. Robinson, Susan Zolla-Pazner, Dennis R. Burton, and David T. Evans. Comparison of Antibody-Dependent Cell-Mediated Cytotoxicity and Virus Neutralization by HIV-1 Env-Specific Monoclonal Antibodies. J. Virol., 90(13):6127-6139, 1 Jul 2016. PubMed ID: 27122574. Show all entries for this paper.
Wisnewski1995 A. Wisnewski, L. Cavacini, G. Kingsbury, D. Sadden, and M. Posner. Anti-HIV Human Monoclonal Antibody Variable Region Gene Usage. J. Cell Biochem., supple 21 B:229, 1995. Show all entries for this paper.
Wisnewski1996 A. Wisnewski, L. Cavacini, and M. Posner. Human antibody variable region gene usage in HIV-1 infection. J. Acquir. Immune Defic. Syndr. Hum. Retrovirol., 11:31-38, 1996. PubMed ID: 8528730. Show all entries for this paper.
Xu1991 J.-Y. Xu, M. K. Gorny, T. Palker, S. Karwowska, and S. Zolla-Pazner. Epitope mapping of two immunodominant domains of gp41, the transmembrane protein of human immunodeficiency virus type 1, using ten human monoclonal antibodies. J. Virol., 65:4832-4838, 1991. The immunodominance of linear epitope in the region 590-600 of gp41 (cluster I) was established, and a second conformational epitope was mapped that reacted with a region between amino acids 644 and 663 (cluster II). Titration experiments showed that there was 100-fold more antibody to cluster I than cluster II in patient sera. PubMed ID: 1714520. Show all entries for this paper.
Yates2018 Nicole L. Yates, Allan C. deCamp, Bette T. Korber, Hua-Xin Liao, Carmela Irene, Abraham Pinter, James Peacock, Linda J. Harris, Sheetal Sawant, Peter Hraber, Xiaoying Shen, Supachai Rerks-Ngarm, Punnee Pitisuttithum, Sorachai Nitayapan, Phillip W. Berman, Merlin L. Robb, Giuseppe Pantaleo, Susan Zolla-Pazner, Barton F. Haynes, S. Munir Alam, David C. Montefiori, and Georgia D. Tomaras. HIV-1 Envelope Glycoproteins from Diverse Clades Differentiate Antibody Responses and Durability among Vaccinees. J. Virol., 92(8), 15 Apr 2018. PubMed ID: 29386288. Show all entries for this paper.
Yuan2009 Wen Yuan, Xing Li, Marta Kasterka, Miroslaw K. Gorny, Susan Zolla-Pazner, and Joseph Sodroski. Oligomer-Specific Conformations of the Human Immunodeficiency Virus (HIV-1) gp41 Envelope Glycoprotein Ectodomain Recognized by Human Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 25(3):319-328, Mar 2009. PubMed ID: 19292593. Show all entries for this paper.
Joshi2020 Vinita R. Joshi, Ruchi M. Newman, Melissa L. Pack, Karen A. Power, James B. Munro, Ken Okawa, Navid Madani, Joseph G. Sodroski, Aaron G. Schmidt, and Todd M. Allen. Gp41-targeted antibodies restore infectivity of a fusion-deficient HIV-1 envelope glycoprotein. PLoS Pathog, 16(5):e1008577 doi, May 2020. PubMed ID: 32392227 Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | D50 | |
---|---|---|
HXB2 Location | gp160(642-665) DNA(8148..8219) |
gp160 Epitope Map |
Author Location | gp41(642-665) | |
Research Contact | Patricia Earl and Christopher Broder, NIH | |
Epitope |
IHSLIEESQNQQEKNEQELLELDK
|
Epitope Alignment |
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | mouse | |
Patient | ||
Immunogen | vaccine | |
Keywords | antibody binding site, antibody generation, antibody interactions, binding affinity, neutralization, review |
Vaccine type | protein |
---|---|
Vaccine component | Env dimers |
Showing 16 of 16 notes.
Showing 16 of 16 references.
Isolation Paper
Earl1994
P. L. Earl, C. C. Broder, D. Long, S. A. Lee, J. Peterson, S. Chakrabarti, R. W. Doms, and B. Moss. Native oligomeric human immunodeficiency virus type 1 Envelope glycoprotein elicits diverse monoclonal antibody reactivities. J. Virol., 68:3015-3026, 1994. In a study of the repertoire of response to oligomeric versus monomeric Env protein, 138 murine MAbs were generated in response to an immunogen that was a gp120/bp41 oligomeric molecule that was not cleaved due to a mutation in the cleavage site. The oligomeric molecule was found to elicit a response that was very different than the monomer. Most MAbs were conformational, many were to gp41 or if in gp120, to the CD4 BS. Few MAbs to linear V3 epitopes were produced in response to oligomeric protein, though this was a common specificity in response to immunization with gp120 monomeric protein. PubMed ID: 7512157.
Show all entries for this paper.
Binley1996 J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976. Show all entries for this paper.
Bontjer2010 Ilja Bontjer, Mark Melchers, Dirk Eggink, Kathryn David, John P. Moore, Ben Berkhout, and Rogier W. Sanders. Stabilized HIV-1 Envelope Glycoprotein Trimers Lacking the V1V2 Domain, Obtained by Virus Evolution. J. Biol. Chem, 285(47):36456-36470, 19 Nov 2010. PubMed ID: 20826824. Show all entries for this paper.
Cognasse2009 Fabrice Cognasse, Hind Hamzeh-Cognasse, Julien Berthet, Pauline Damien, Frédéric Lucht, Bruno Pozzetto, and Olivier Garraud. Altered Release of Regulated upon Activation, Normal T-Cell Expressed and Secreted Protein from Human, Normal Platelets: Contribution of Distinct HIV-1MN gp41 Peptides. AIDS, 23(15):2057-2059, 24 Sep 2009. PubMed ID: 19654498. Show all entries for this paper.
deRosny2004 Eve de Rosny, Russell Vassell, Shibo Jiang, Renate Kunert, and Carol D. Weiss. Binding of the 2F5 Monoclonal Antibody to Native and Fusion-Intermediate Forms of Human Immunodeficiency Virus Type 1 gp41: Implications for Fusion-Inducing Conformational Changes. J. Virol., 78(5):2627-2631, Mar 2004. PubMed ID: 14963170. Show all entries for this paper.
Earl1997 P. L. Earl, C. C. Broder, R. W. Doms, and B. Moss. Epitope map of human immunodeficiency virus type 1 gp41 derived from 47 monoclonal antibodies produced by immunization with oligomeric envelope protein. J. Virol., 71:2674-84, 1997. PubMed ID: 9060620. Show all entries for this paper.
Haynes2005a Barton F. Haynes, M. Anthony Moody, Laurent Verkoczy, Garnett Kelsoe, and S. Munir Alam. Antibody Polyspecificity and Neutralization of HIV-1: A Hypothesis. Hum. Antibodies, 14(3-4):59-67, 2005. PubMed ID: 16720975. Show all entries for this paper.
Haynes2006a Barton F. Haynes and David C. Montefiori. Aiming to Induce Broadly Reactive Neutralizing Antibody Responses with HIV-1 Vaccine Candidates. Expert Rev. Vaccines, 5(4):579-595, Aug 2006. PubMed ID: 16989638. Show all entries for this paper.
Leaman2010 Daniel P. Leaman, Heather Kinkead, and Michael B. Zwick. In-Solution Virus Capture Assay Helps Deconstruct Heterogeneous Antibody Recognition of Human Immunodeficiency Virus Type 1. J. Virol., 84(7):3382-3395, Apr 2010. PubMed ID: 20089658. Show all entries for this paper.
Nelson2008 Josh D. Nelson, Heather Kinkead, Florence M. Brunel, Dan Leaman, Richard Jensen, John M. Louis, Toshiaki Maruyama, Carole A. Bewley, Katherine Bowdish, G. Marius Clore, Philip E. Dawson, Shana Frederickson, Rose G. Mage, Douglas D. Richman, Dennis R. Burton, and Michael B. Zwick. Antibody Elicited against the gp41 N-Heptad Repeat (NHR) Coiled-Coil Can Neutralize HIV-1 with Modest Potency but Non-Neutralizing Antibodies Also Bind to NHR Mimetics. Virology, 377(1):170-183, 20 Jul 2008. PubMed ID: 18499210. Show all entries for this paper.
Pantophlet2009 Ralph Pantophlet, Meng Wang, Rowena O. Aguilar-Sino, and Dennis R. Burton. The Human Immunodeficiency Virus Type 1 Envelope Spike of Primary Viruses Can Suppress Antibody Access to Variable Regions. J. Virol., 83(4):1649-1659, Feb 2009. PubMed ID: 19036813. Show all entries for this paper.
Pietzsch2010 John Pietzsch, Johannes F. Scheid, Hugo Mouquet, Michael S. Seaman, Christopher C. Broder, and Michel C. Nussenzweig. Anti-gp41 Antibodies Cloned from HIV-Infected Patients with Broadly Neutralizing Serologic Activity. J. Virol., 84(10):5032-5042, May 2010. PubMed ID: 20219932. Show all entries for this paper.
Richardson1996 T. M. Richardson, Jr., B. L. Stryjewski, C. C. Broder, J. A. Hoxie, J. R. Mascola, P. L. Earl, and R. W. Doms. Humoral response to oligomeric human immunodeficiency virus type 1 envelope protein. J. Virol., 70:753-62, 1996. An Env antigen capture enzyme-linked immunosorbent assay using a soluble, oligomeric form of HIV-1IIIB Env (gp140) that contains gp120 and the gp41 ectodomain was developed. The gp140, captured by various monoclonal antibodies (MAbs), retained its native oligomeric structure: it bound CD4 and was recognized by MAbs to conformational epitopes in gp120 and gp41, including oligomer-specific epitopes in gp41. PubMed ID: 8551612. Show all entries for this paper.
Srivastava2002 Indresh K. Srivastava, Leonidas Stamatatos, Harold Legg, Elaine Kan, Anne Fong, Stephen R. Coates, Louisa Leung, Mark Wininger, John J. Donnelly, Jeffrey B. Ulmer, and Susan W. Barnett. Purification and Characterization of Oligomeric Envelope Glycoprotein from a Primary R5 Subtype B Human Immunodeficiency Virus. J. Virol., 76(6):2835-2847, Mar 2002. URL: http://jvi.asm.org/cgi/content/full/76/6/2835. PubMed ID: 11861851. Show all entries for this paper.
Yang2000 Xinzhen Yang, Michael Farzan, Richard Wyatt, and Joseph Sodroski. Characterization of Stable, Soluble Trimers Containing Complete Ectodomains of Human Immunodeficiency Virus Type 1 Envelope Glycoproteins. J. Virol., 74(12):5716-5725, Jun 2000. PubMed ID: 10823881. Show all entries for this paper.
Zhang2008 Mei-Yun Zhang, Bang K. Vu, Anil Choudhary, Hong Lu, Michael Humbert, Helena Ong, Munir Alam, Ruth M. Ruprecht, Gerald Quinnan, Shibo Jiang, David C. Montefiori, John R. Mascola, Christopher C. Broder, Barton F. Haynes, and Dimiter S. Dimitrov. Cross-Reactive Human Immunodeficiency Virus Type 1-Neutralizing Human Monoclonal Antibody That Recognizes a Novel Conformational Epitope on gp41 and Lacks Reactivity against Self-Antigens. J. Virol., 82(14):6869-6879, Jul 2008. PubMed ID: 18480433. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab G1 | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | G | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab T3 (T3) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, binding affinity, neutralization, review |
Showing 5 of 5 notes.
Showing 5 of 5 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Moore2006 Penny L. Moore, Emma T. Crooks, Lauren Porter, Ping Zhu, Charmagne S. Cayanan, Henry Grise, Paul Corcoran, Michael B. Zwick, Michael Franti, Lynn Morris, Kenneth H. Roux, Dennis R. Burton, and James M. Binley. Nature of Nonfunctional Envelope Proteins on the Surface of Human Immunodeficiency Virus Type 1. J. Virol., 80(5):2515-2528, Mar 2006. PubMed ID: 16474158. Show all entries for this paper.
Crooks2008 Emma T. Crooks, Pengfei Jiang, Michael Franti, Sharon Wong, Michael B. Zwick, James A. Hoxie, James E. Robinson, Penny L. Moore, and James M. Binley. Relationship of HIV-1 and SIV Envelope Glycoprotein Trimer Occupation and Neutralization. Virology, 377(2):364-378, 1 Aug 2008. PubMed ID: 18539308. Show all entries for this paper.
Nelson2008 Josh D. Nelson, Heather Kinkead, Florence M. Brunel, Dan Leaman, Richard Jensen, John M. Louis, Toshiaki Maruyama, Carole A. Bewley, Katherine Bowdish, G. Marius Clore, Philip E. Dawson, Shana Frederickson, Rose G. Mage, Douglas D. Richman, Dennis R. Burton, and Michael B. Zwick. Antibody Elicited against the gp41 N-Heptad Repeat (NHR) Coiled-Coil Can Neutralize HIV-1 with Modest Potency but Non-Neutralizing Antibodies Also Bind to NHR Mimetics. Virology, 377(1):170-183, 20 Jul 2008. PubMed ID: 18499210. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab M10 | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Parren1997 P. W. Parren, M. C. Gauduin, R. A. Koup, P. Poignard, Q. J. Sattentau, P. Fisicaro, and D. R. Burton. Erratum to Relevance of the Antibody Response against Human Immunodeficiency Virus Type 1 Envelope to Vaccine Design. Immunol. Lett., 58:125-132, 1997. corrected and republished article originally printed in Immunol. Lett. 1997 Jun;57(1-3):105-112. PubMed ID: 9271324. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab M12 (M12) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody sequence, review |
Showing 3 of 3 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab M15 | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | M | |
Immunogen | HIV-1 infection | |
Keywords | review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab S6 (S6) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | S | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody interactions, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab S8 (S8) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | S | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody interactions, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab S9 (S9) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | S | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody interactions, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab S10 (S10) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | S | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab L2 (L2) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Research Contact | P. Perrin and D. Burton (Scripps Research Institute, La Jolla, California | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster III | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | L | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 3 of 3 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Earl1997 P. L. Earl, C. C. Broder, R. W. Doms, and B. Moss. Epitope map of human immunodeficiency virus type 1 gp41 derived from 47 monoclonal antibodies produced by immunization with oligomeric envelope protein. J. Virol., 71:2674-84, 1997. PubMed ID: 9060620. Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab L11 (L11) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster III | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | L | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab L1 (L1) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster III | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | L | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab G5 | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster III | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | G | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab G15 (G15) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster III | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | G | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab A12 | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | A | |
Immunogen | HIV-1 infection | |
Keywords |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab A9 (A9) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster III | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | A | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab L9 | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | L | |
Immunogen | HIV-1 infection | |
Keywords |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab A2 | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1λ) | |
Patient | A | |
Immunogen | HIV-1 infection | |
Keywords |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | 50-69 (SZ-50.69, 50-69D, 50.69, 50-6910) | |
---|---|---|
HXB2 Location | Env DNA(7959..8033) |
Env Epitope Map |
Author Location | gp41( BH10) | |
Research Contact | Susan Zolla-Pazner (Zollas01@mcrcr6.med.nyu), NYU, NY | |
Epitope |
(Discontinuous epitope)
|
|
Ab Type | gp41 cluster I | |
Neutralizing | ||
Species (Isotype) | human(IgG2κ) | |
Patient | ||
Immunogen | HIV-1 infection | |
Keywords | ADCC, antibody binding site, antibody generation, antibody interactions, antibody polyreactivity, antibody sequence, binding affinity, complement, dendritic cells, enhancing activity, immunotoxin, kinetics, mimotopes, neutralization, rate of progression, review, subtype comparisons, vaccine antigen design, vaccine-induced immune responses, variant cross-reactivity |
Showing 44 of 44 notes.
Showing 44 of 44 references.
Isolation Paper
Gorny1989
M. K. Gorny, V. Gianakakos, S. Sharpe, and S. Zolla-Pazner. Generation of human monoclonal antibodies to human immunodeficiency virus. Proc. Natl. Acad. Sci. U.S.A., 86:1624-1628, 1989. This paper described immortalization of B-cells from HIV-1 positive individuals with Epstein-Barr virus, to produce seven stable antibody producing cell lines. PubMed ID: 2922401.
Show all entries for this paper.
Binley1996 J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976. Show all entries for this paper.
Boots1997 L. J. Boots, P. M. McKenna, B. A. Arnold, P. M. Keller, M. K. Gorny, S. Zolla-Pazner, J. E. Robinson, and A. J. Conley. Anti-human immunodeficiency virus type 1 human monoclonal antibodies that bind discontinuous epitopes in the viral glycoproteins can identify mimotopes from recombinant phage peptide display libraries. AIDS Res. Hum. Retroviruses, 13:1549-59, 1997. PubMed ID: 9430247. Show all entries for this paper.
Chen1995 C. H. Chen, T. J. Matthews, C. B. McDanal, D. P. Bolognesi, and M. L. Greenberg. A Molecular Clasp in the Human Immunodeficiency Virus (HIV) Type 1 TM Protein Determines the Anti-HIV Activity of gp41 Derivatives: Implication for Viral Fusion. J. Virol., 69:3771-3777, 1995. PubMed ID: 7538176. Show all entries for this paper.
Dennison2011a S. Moses Dennison, Kara Anasti, Richard M. Scearce, Laura Sutherland, Robert Parks, Shi-Mao Xia, Hua-Xin Liao, Miroslaw K. Gorny, Susan Zolla-Pazner, Barton F. Haynes, and S. Munir Alam. Nonneutralizing HIV-1 gp41 Envelope Cluster II Human Monoclonal Antibodies Show Polyreactivity for Binding to Phospholipids and Protein Autoantigens. J. Virol., 85(3):1340-1347, Feb 2011. PubMed ID: 21106741. Show all entries for this paper.
Eddleston1993 M. Eddleston, J. C. de la Torre, J.-Y. Xu, N. Dorfman, A. Notkins, S. Zolla-Pazner, and M. B. A. Oldstone. Molecular Mimicry Accompanying HIV-1 Infection: Human Monoclonal Antibodies That Bind to gp41 and to Astrocytes. AIDS Res. Hum. Retroviruses, 10:939-944, 1993. In this paper, three anti-HIV-1 gp41 specific MAbs were found to react with astrocytes: 98-6, 167-7 and 15G1. Reactive astrocytes in the hippocampus were most prominently involved, and the antibodies stained no other cell type in the brain, kidney or liver. All three mapped to a conformationally dependent epitope between aa 644-663. PubMed ID: 7506553. Show all entries for this paper.
Finnegan2002 Catherine M. Finnegan, Werner Berg, George K. Lewis, and Anthony L. DeVico. Antigenic Properties of the Human Immunodeficiency Virus Transmembrane Glycoprotein during Cell-Cell Fusion. J. Virol., 76(23):12123-12134, Dec 2002. PubMed ID: 12414953. Show all entries for this paper.
Follis2002 Kathryn E. Follis, Scott J. Larson, Min Lu, and Jack H. Nunberg. Genetic Evidence that Interhelical Packing Interactions in the gp41 Core Are Critical for Transition of the Human Immunodeficiency Virus Type 1 Envelope Glycoprotein to the Fusion-Active State. J. Virol., 76(14):7356-7362, Jul 2002. PubMed ID: 12072535. Show all entries for this paper.
Gorny2000a M. K. Gorny and S. Zolla-Pazner. Recognition by Human Monoclonal Antibodies of Free and Complexed Peptides Representing the Prefusogenic and Fusogenic Forms of Human Immunodeficiency Virus Type 1 gp41. J. Virol., 74:6186-6192, 2000. PubMed ID: 10846104. Show all entries for this paper.
Gorny2000b M. K. Gorny, T. C. VanCott, C. Williams, K. Revesz, and S. Zolla-Pazner. Effects of oligomerization on the epitopes of the human immunodeficiency virus type 1 envelope glycoproteins. Virology, 267:220-8, 2000. PubMed ID: 10662617. Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Gorny2009 Miroslaw K. Gorny, Xiao-Hong Wang, Constance Williams, Barbara Volsky, Kathy Revesz, Bradley Witover, Sherri Burda, Mateusz Urbanski, Phillipe Nyambi, Chavdar Krachmarov, Abraham Pinter, Susan Zolla-Pazner, and Arthur Nadas. Preferential Use of the VH5-51 Gene Segment by the Human Immune Response to Code for Antibodies against the V3 Domain of HIV-1. Mol. Immunol., 46(5):917-926, Feb 2009. PubMed ID: 18952295. Show all entries for this paper.
Hioe1997b C. E. Hioe, S. Xu, P. Chigurupati, S. Burda, C. Williams, M. K. Gorny, and S. Zolla-Pazner. Neutralization of HIV-1 Primary Isolates by Polyclonal and Monoclonal Human Antibodies. Int. Immunol., 9(9):1281-1290, Sep 1997. PubMed ID: 9310831. Show all entries for this paper.
Holl2006 Vincent Holl, Maryse Peressin, Thomas Decoville, Sylvie Schmidt, Susan Zolla-Pazner, Anne-Marie Aubertin, and Christiane Moog. Nonneutralizing Antibodies Are Able To Inhibit Human Immunodeficiency Virus Type 1 Replication in Macrophages and Immature Dendritic Cells. J. Virol., 80(12):6177-6181, Jun 2006. PubMed ID: 16731957. Show all entries for this paper.
Huang2007 Li Huang, Weihong Lai, Phong Ho, and Chin Ho Chen. Induction of a Nonproductive Conformational Change in gp120 by a Small Molecule HIV Type 1 Entry Inhibitor. AIDS Res. Hum. Retroviruses, 23(1):28-32, Jan 2007. PubMed ID: 17263629. Show all entries for this paper.
Kalia2005 Vandana Kalia, Surojit Sarkar, Phalguni Gupta, and Ronald C. Montelaro. Antibody Neutralization Escape Mediated by Point Mutations in the Intracytoplasmic Tail of Human Immunodeficiency Virus Type 1 gp41. J. Virol., 79(4):2097-2107, Feb 2005. PubMed ID: 15681412. Show all entries for this paper.
Kim2007 Mikyung Kim, Zhisong Qiao, Jessica Yu, David Montefiori, and Ellis L. Reinherz. Immunogenicity of Recombinant Human Immunodeficiency Virus Type 1-Like Particles Expressing gp41 Derivatives in a Pre-Fusion State. Vaccine, 25(27):5102-5114, 28 Jun 2007. PubMed ID: 17055621. Show all entries for this paper.
Klasse1996 P. J. Klasse and Q. J. Sattentau. Altered CD4 Interactions of HIV Type 1 LAI Variants Selected for the Capacity to Induce Membrane Fusion in the Presence of a Monoclonal Antibody to Domain 2 of CD4. AIDS Res. Hum. Retroviruses, 12:1015-1021, 1996. PubMed ID: 8827217. Show all entries for this paper.
Laal1994 Suman Laal, Sherri Burda, Miroslav K. Gorny, Sylwia Karwowska, Aby Buchbinder, and Susan Zolla-Pazner. Synergistic Neutralization of Human Immunodeficiency Virus Type 1 by Combinations of Human Monoclonal Antibodies. J. Virol., 68(6):4001-4008, Jun 1994. PubMed ID: 7514683. Show all entries for this paper.
Ling2004 Hong Ling, Peng Xiao, Osamu Usami, and Toshio Hattori. Thrombin Activates Envelope Glycoproteins of HIV Type 1 and Enhances Fusion. Microbes Infect., 6(5):414-420, Apr 2004. PubMed ID: 15109955. Show all entries for this paper.
Manca1995 F. Manca, D. Fenoglio, M. T. Valle, G. L. Pira, A. Kunkl, R. S. Balderas, R. G. Baccala, D. H. Kono, A. Ferraris, D. Saverino, F. Lancia, L. Lozzi, and A. N. Theofilopoulos. Human T helper cells specific for HIV reverse transcriptase: possible role in intrastructural help for HIV envelope-specific antibodies. Eur. J. Immunol., 25:1217-1223, 1995. PubMed ID: 7539750. Show all entries for this paper.
McCaffrey2004 Ruth A McCaffrey, Cheryl Saunders, Mike Hensel, and Leonidas Stamatatos. N-Linked Glycosylation of the V3 Loop and the Immunologically Silent Face of gp120 Protects Human Immunodeficiency Virus Type 1 SF162 from Neutralization by Anti-gp120 and Anti-gp41 Antibodies. J. Virol., 78(7):3279-3295, Apr 2004. PubMed ID: 15016849. Show all entries for this paper.
McDougal1996 J. S. McDougal, M. S. Kennedy, S. L. Orloff, J. K. A. Nicholson, and T. J. Spira. Mechanisms of Human Immunodeficiency Virus Type 1 (HIV-1) Neutralization: Irreversible Inactivation of Infectivity by Anti-HIV-1 Antibody. J. Virol., 70:5236-5245, 1996. Studies of polyclonal sera autologous virus inactivation indicates that in individuals over time, viral populations emerge that are resistant to inactivating effects of earlier sera. PubMed ID: 8764033. Show all entries for this paper.
Mitchell1998 W. M. Mitchell, L. Ding, and J. Gabriel. Inactivation of a Common Epitope Responsible for the Induction of Antibody-Dependent Enhancement of HIV. AIDS, 12:147-156, 1998. PubMed ID: 9468363. Show all entries for this paper.
Nyambi2000 P. N. Nyambi, H. A. Mbah, S. Burda, C. Williams, M. K. Gorny, A. Nadas, and S. Zolla-Pazner. Conserved and Exposed Epitopes on Intact, Native, Primary Human Immunodeficiency Virus Type 1 Virions of Group M. J. Virol., 74:7096-7107, 2000. PubMed ID: 10888650. Show all entries for this paper.
Pinter1989 A. Pinter, W. J. Honnen, S. A. Tilley, C. Bona, H. Zaghouani, M. K. Gorny, and S. Zolla-Pazner. Oligomeric Structure of gp41, the Transmembrane Protein of Human Immunodeficiency Virus Type 1. J. Virol., 63:2674-2679, 1989. PubMed ID: 2786089. Show all entries for this paper.
Poignard1996b P. Poignard, T. Fouts, D. Naniche, J. P. Moore, and Q. J. Sattentau. Neutralizing antibodies to human immunodeficiency virus type-1 gp120 induce envelope glycoprotein subunit dissociation. J. Exp. Med., 183:473-484, 1996. Binding of Anti-V3 and the CD4I neutralizing MAbs induces shedding of gp120 on cells infected with the T-cell line-adapted HIV-1 molecular clone Hx10. This was shown by significant increases of gp120 in the supernatant, and exposure of a gp41 epitope that is masked in the oligomer. MAbs binding either to the V2 loop or to CD4BS discontinuous epitopes do not induce gp120 dissociation. This suggests HIV neutralization probably is caused by several mechanisms, and one of the mechanisms may involve gp120 dissociation. PubMed ID: 8627160. Show all entries for this paper.
Pollara2013 Justin Pollara, Mattia Bonsignori, M. Anthony Moody, Marzena Pazgier, Barton F. Haynes, and Guido Ferrari. Epitope Specificity of Human Immunodeficiency Virus-1 Antibody Dependent Cellular Cytotoxicity (ADCC) Responses. Curr. HIV Res., 11(5):378-387, Jul 2013. PubMed ID: 24191939. Show all entries for this paper.
Robinson1991 W. E. Robinson, M. K. Gorny, J.-Y. Xu, W. M. Mitchell, and S. Zolla-Pazner. Two Immunodominant Domains of gp41 Bind Antibodies Which Enhance Human Immunodeficiency Virus Type 1 Infection In Vitro. J. Virol., 65:4169-4176, 1991. PubMed ID: 2072448. Show all entries for this paper.
Sattentau1991 Q. J. Sattentau and J. P. Moore. Conformational Changes Induced in the Human Immunodeficiency Virus Envelope Glycoprotein by Soluble CD4 Binding. J. Exp. Med., 174:407-415, 1991. sCD4 binding to gp120 induces conformational changes within envelope oligomers. This was measured on HIV-1-infected cells by the increased binding of gp120/V3 loop specific MAbs, and on the surface of virions by increased cleavage of the V3 loop by an exogenous proteinase. PubMed ID: 1713252. Show all entries for this paper.
Sattentau1995 Q. J. Sattentau, S. Zolla-Pazner, and P. Poignard. Epitope Exposure on Functional, Oligomeric HIV-1 gp41 Molecules. Virology, 206:713-717, 1995. Most gp41 epitopes are masked when associated with gp120 on the cell surface. Weak binding of anti-gp41 MAbs can be enhanced by treatment with sCD4. MAb 2F5 binds to a membrane proximal epitope which binds in the presence of gp120 without sCD4. PubMed ID: 7530400. Show all entries for this paper.
Sheppard2007a Neil C. Sheppard, Sarah L. Davies, Simon A. Jeffs, Sueli M. Vieira, and Quentin J. Sattentau. Production and Characterization of High-Affinity Human Monoclonal Antibodies to Human Immunodeficiency Virus Type 1 Envelope Glycoproteins in a Mouse Model Expressing Human Immunoglobulins. Clin. Vaccine Immunol., 14(2):157-167, Feb 2007. PubMed ID: 17167037. Show all entries for this paper.
Spear1993 G. T. Spear, D. M. Takefman, B. L. Sullivan, A. L. Landay, and S. Zolla-Pazner. Complement activation by human monoclonal antibodies to human immunodeficiency virus. J. Virol., 67:53-59, 1993. This study looked at the ability of 16 human MAbs to activate complement. MAbs directed against the V3 region could induce C3 deposition on infected cells and virolysis of free virus, but antibodies to the CD4BS and C-terminal region and two regions in gp41 could induce no complement mediated effects. Pre-treatment with sCD4 could increase complement-mediated effects of anti-gp41 MAbs, but decreased the complement-mediated effects of V3 MAbs. Anti-gp41 MAbs were able to affect IIIB but not MN virolysis, suggesting spontaneous shedding of gp120 on IIIB virions exposes gp41 epitopes. IgG isotype did not appear to have an effect on virolysis or C3 deposition. PubMed ID: 7677959. Show all entries for this paper.
Stamatatos1997 L. Stamatatos, S. Zolla-Pazner, M. K. Gorny, and C. Cheng-Mayer. Binding of Antibodies to Virion-Associated gp120 Molecules of Primary-Like Human Immunodeficiency Virus Type 1 (HIV-1) Isolates: Effect on HIV-1 Infection of Macrophages and Peripheral Blood Mononuclear Cells. Virology, 229:360-369, 1997. PubMed ID: 9126249. Show all entries for this paper.
Till1989 M. A. Till, S. Zolla-Pazner, M. K. Gorny, J. W. Uhr, and E. S. Vitetta. Human Immunodeficiency Virus-Infected T Cells and Monocytes Are Killed by Monoclonal Human Anti-gp41 Antibodies Coupled to Ricin A Chain. Proc. Natl. Acad. Sci. U.S.A., 86:1987-1991, 1989. PubMed ID: 2538826. Show all entries for this paper.
Tyler1990 D. S. Tyler, S. D. Stanley, S. Zolla-Pazner, M. K. Gorny, P. P. Shadduck, A. J. Langlois, T. J. Matthews, D. P. Bolognesi, T. J. Palker, and K. J. Weinhold. Identification of sites within gp41 that serve as targets for antibody-dependent cellular cytotoxicity by using human monoclonal antibodies. J. Immunol., 145:3276-3282, 1990. PubMed ID: 1700004. Show all entries for this paper.
Usami2005 Osamu Usami, Peng Xiao, Hong Ling, Yi Liu, Tadashi Nakasone, and Toshio Hattori. Properties of Anti-gp41 Core Structure Antibodies, Which Compete with Sera of HIV-1-Infected Patients. Microbes Infect., 7(4):650-657, Apr 2005. PubMed ID: 15823513. Show all entries for this paper.
Verrier2001 F. Verrier, A. Nadas, M. K. Gorny, and S. Zolla-Pazner. Additive effects characterize the interaction of antibodies involved in neutralization of the primary dualtropic human immunodeficiency virus type 1 isolate 89.6. J. Virol., 75(19):9177--86, Oct 2001. URL: http://jvi.asm.org/cgi/content/full/75/19/9177. PubMed ID: 11533181. Show all entries for this paper.
Vincent2008 Nadine Vincent, Amadou Kone, Blandine Chanut, Frédéric Lucht, Christian Genin, and Etienne Malvoisin. Antibodies Purified from Sera of HIV-1-Infected Patients by Affinity on the Heptad Repeat Region 1/Heptad Repeat Region 2 Complex of gp41 Neutralize HIV-1 Primary Isolates. AIDS, 22(16):2075-2085, 18 Oct 2008. PubMed ID: 18832871. Show all entries for this paper.
Vincent2012 Nadine Vincent and Etienne Malvoisin. Ability of Antibodies Specific to the HIV-1 Envelope Glycoprotein to Block the Fusion Inhibitor T20 in a Cell-Cell Fusion Assay. Immunobiology, 217(10):943-950, Oct 2012. PubMed ID: 22387075. Show all entries for this paper.
Xu1991 J.-Y. Xu, M. K. Gorny, T. Palker, S. Karwowska, and S. Zolla-Pazner. Epitope mapping of two immunodominant domains of gp41, the transmembrane protein of human immunodeficiency virus type 1, using ten human monoclonal antibodies. J. Virol., 65:4832-4838, 1991. The immunodominance of linear epitope in the region 590-600 of gp41 (cluster I) was established, and a second conformational epitope was mapped that reacted with a region between amino acids 644 and 663 (cluster II). Titration experiments showed that there was 100-fold more antibody to cluster I than cluster II in patient sera. PubMed ID: 1714520. Show all entries for this paper.
Yates2018 Nicole L. Yates, Allan C. deCamp, Bette T. Korber, Hua-Xin Liao, Carmela Irene, Abraham Pinter, James Peacock, Linda J. Harris, Sheetal Sawant, Peter Hraber, Xiaoying Shen, Supachai Rerks-Ngarm, Punnee Pitisuttithum, Sorachai Nitayapan, Phillip W. Berman, Merlin L. Robb, Giuseppe Pantaleo, Susan Zolla-Pazner, Barton F. Haynes, S. Munir Alam, David C. Montefiori, and Georgia D. Tomaras. HIV-1 Envelope Glycoproteins from Diverse Clades Differentiate Antibody Responses and Durability among Vaccinees. J. Virol., 92(8), 15 Apr 2018. PubMed ID: 29386288. Show all entries for this paper.
Yuan2009 Wen Yuan, Xing Li, Marta Kasterka, Miroslaw K. Gorny, Susan Zolla-Pazner, and Joseph Sodroski. Oligomer-Specific Conformations of the Human Immunodeficiency Virus (HIV-1) gp41 Envelope Glycoprotein Ectodomain Recognized by Human Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 25(3):319-328, Mar 2009. PubMed ID: 19292593. Show all entries for this paper.
Zwick2001b M. B. Zwick, A. F. Labrijn, M. Wang, C. Spenlehauer, E. O. Saphire, J. M. Binley, J. P. Moore, G. Stiegler, H. Katinger, D. R. Burton, and P. W. Parren. Broadly neutralizing antibodies targeted to the membrane-proximal external region of human immunodeficiency virus type 1 glycoprotein gp41. J. Virol., 75(22):10892--905, Nov 2001. URL: http://jvi.asm.org/cgi/content/full/75/22/10892. PubMed ID: 11602729. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | 126-6 (SZ-126.6) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( HXB2) | |
Research Contact | Susan Zolla-Pazner (Zollas01@mcrcr6.med.nyu), NYU Med Center, NY, NY | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG2κ) | |
Patient | donor_uncoded_3 | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody interactions, antibody polyreactivity, binding affinity, dendritic cells, enhancing activity, kinetics, neutralization, review, structure, subtype comparisons, variant cross-reactivity |
Showing 16 of 16 notes.
Showing 17 of 17 references.
Isolation Paper
Robinson1990a
W. E. Robinson, Jr., T. Kawamura, M. K. Gorny, D. Lake, J.-Y. Xu, Y. Matsumoto, T. Sugano, Y. Masuho, W. M. Mitchell, E. Hersh, and S. Zolla-Pazner. Human Monoclonal Antibodies to the Human Immunodeficiency Virus Type 1 (HIV-1) Transmembrane Glycoprotein gp41 Enhance HIV-1 Infection In Vitro. Proc. Natl. Acad. Sci. U.S.A., 87:3185-3189, 1990. Three gp41 MAbs out of 16 Env and Gag MAbs tested enhanced HIV-1 IIIB infection of MT-2 cells. The enhancing antibodies were competitive with the immunodominant epitopes of gp41 recognized by sera from HIV-1 infected subjects. PubMed ID: 2326277.
Show all entries for this paper.
Robinson1991 W. E. Robinson, M. K. Gorny, J.-Y. Xu, W. M. Mitchell, and S. Zolla-Pazner. Two Immunodominant Domains of gp41 Bind Antibodies Which Enhance Human Immunodeficiency Virus Type 1 Infection In Vitro. J. Virol., 65:4169-4176, 1991. PubMed ID: 2072448. Show all entries for this paper.
Xu1991 J.-Y. Xu, M. K. Gorny, T. Palker, S. Karwowska, and S. Zolla-Pazner. Epitope mapping of two immunodominant domains of gp41, the transmembrane protein of human immunodeficiency virus type 1, using ten human monoclonal antibodies. J. Virol., 65:4832-4838, 1991. The immunodominance of linear epitope in the region 590-600 of gp41 (cluster I) was established, and a second conformational epitope was mapped that reacted with a region between amino acids 644 and 663 (cluster II). Titration experiments showed that there was 100-fold more antibody to cluster I than cluster II in patient sera. PubMed ID: 1714520. Show all entries for this paper.
Eddleston1993 M. Eddleston, J. C. de la Torre, J.-Y. Xu, N. Dorfman, A. Notkins, S. Zolla-Pazner, and M. B. A. Oldstone. Molecular Mimicry Accompanying HIV-1 Infection: Human Monoclonal Antibodies That Bind to gp41 and to Astrocytes. AIDS Res. Hum. Retroviruses, 10:939-944, 1993. In this paper, three anti-HIV-1 gp41 specific MAbs were found to react with astrocytes: 98-6, 167-7 and 15G1. Reactive astrocytes in the hippocampus were most prominently involved, and the antibodies stained no other cell type in the brain, kidney or liver. All three mapped to a conformationally dependent epitope between aa 644-663. PubMed ID: 7506553. Show all entries for this paper.
Chen1995 C. H. Chen, T. J. Matthews, C. B. McDanal, D. P. Bolognesi, and M. L. Greenberg. A Molecular Clasp in the Human Immunodeficiency Virus (HIV) Type 1 TM Protein Determines the Anti-HIV Activity of gp41 Derivatives: Implication for Viral Fusion. J. Virol., 69:3771-3777, 1995. PubMed ID: 7538176. Show all entries for this paper.
Binley1996 J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976. Show all entries for this paper.
Earl1997 P. L. Earl, C. C. Broder, R. W. Doms, and B. Moss. Epitope map of human immunodeficiency virus type 1 gp41 derived from 47 monoclonal antibodies produced by immunization with oligomeric envelope protein. J. Virol., 71:2674-84, 1997. PubMed ID: 9060620. Show all entries for this paper.
Hioe1997b C. E. Hioe, S. Xu, P. Chigurupati, S. Burda, C. Williams, M. K. Gorny, and S. Zolla-Pazner. Neutralization of HIV-1 Primary Isolates by Polyclonal and Monoclonal Human Antibodies. Int. Immunol., 9(9):1281-1290, Sep 1997. PubMed ID: 9310831. Show all entries for this paper.
Gorny2000a M. K. Gorny and S. Zolla-Pazner. Recognition by Human Monoclonal Antibodies of Free and Complexed Peptides Representing the Prefusogenic and Fusogenic Forms of Human Immunodeficiency Virus Type 1 gp41. J. Virol., 74:6186-6192, 2000. PubMed ID: 10846104. Show all entries for this paper.
Nyambi2000 P. N. Nyambi, H. A. Mbah, S. Burda, C. Williams, M. K. Gorny, A. Nadas, and S. Zolla-Pazner. Conserved and Exposed Epitopes on Intact, Native, Primary Human Immunodeficiency Virus Type 1 Virions of Group M. J. Virol., 74:7096-7107, 2000. PubMed ID: 10888650. Show all entries for this paper.
Finnegan2002 Catherine M. Finnegan, Werner Berg, George K. Lewis, and Anthony L. DeVico. Antigenic Properties of the Human Immunodeficiency Virus Transmembrane Glycoprotein during Cell-Cell Fusion. J. Virol., 76(23):12123-12134, Dec 2002. PubMed ID: 12414953. Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Holl2006 Vincent Holl, Maryse Peressin, Thomas Decoville, Sylvie Schmidt, Susan Zolla-Pazner, Anne-Marie Aubertin, and Christiane Moog. Nonneutralizing Antibodies Are Able To Inhibit Human Immunodeficiency Virus Type 1 Replication in Macrophages and Immature Dendritic Cells. J. Virol., 80(12):6177-6181, Jun 2006. PubMed ID: 16731957. Show all entries for this paper.
Alam2008 S. Munir Alam, Richard M. Scearce, Robert J. Parks, Kelly Plonk, Steven G. Plonk, Laura L. Sutherland, Miroslaw K. Gorny, Susan Zolla-Pazner, Stacie VanLeeuwen, M. Anthony Moody, Shi-Mao Xia, David C. Montefiori, Georgia D. Tomaras, Kent J. Weinhold, Salim Abdool Karim, Charles B. Hicks, Hua-Xin Liao, James Robinson, George M. Shaw, and Barton F. Haynes. Human Immunodeficiency Virus Type 1 gp41 Antibodies That Mask Membrane Proximal Region Epitopes: Antibody Binding Kinetics, Induction, and Potential for Regulation in Acute Infection. J. Virol., 82(1):115-125, Jan 2008. PubMed ID: 17942537. Show all entries for this paper.
Yuan2009 Wen Yuan, Xing Li, Marta Kasterka, Miroslaw K. Gorny, Susan Zolla-Pazner, and Joseph Sodroski. Oligomer-Specific Conformations of the Human Immunodeficiency Virus (HIV-1) gp41 Envelope Glycoprotein Ectodomain Recognized by Human Monoclonal Antibodies. AIDS Res. Hum. Retroviruses, 25(3):319-328, Mar 2009. PubMed ID: 19292593. Show all entries for this paper.
Frey2010 Gary Frey, Jia Chen, Sophia Rits-Volloch, Michael M. Freeman, Susan Zolla-Pazner, and Bing Chen. Distinct Conformational States of HIV-1 gp41 Are Recognized by Neutralizing and Non-Neutralizing Antibodies. Nat. Struct. Mol. Biol., 17(12):1486-1491, Dec 2010. PubMed ID: 21076402. Show all entries for this paper.
Dennison2011a S. Moses Dennison, Kara Anasti, Richard M. Scearce, Laura Sutherland, Robert Parks, Shi-Mao Xia, Hua-Xin Liao, Miroslaw K. Gorny, Susan Zolla-Pazner, Barton F. Haynes, and S. Munir Alam. Nonneutralizing HIV-1 gp41 Envelope Cluster II Human Monoclonal Antibodies Show Polyreactivity for Binding to Phospholipids and Protein Autoantigens. J. Virol., 85(3):1340-1347, Feb 2011. PubMed ID: 21106741. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Md-1 (MD-1, Md1) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41 | |
Research Contact | R. A. Myers State of Maryland Dept. of Health | |
Epitope |
|
|
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1λ) | |
Patient | ||
Immunogen | ||
Keywords | antibody binding site, binding affinity, review |
Showing 7 of 7 notes.
Showing 6 of 6 references.
Myers1993 R. Myers, T. Meiller, W. Falkler, Jr., J. Patel, and J. Joseph. A Human Monoclonal Antibody to a Cryptic gp41 Epitope on HIV-1 Infected Cells. Abstr. Gen. Meet. Am. Soc. Microbiol., 93:444, 1993. Aidsline: 93291838 Abstract T70. Show all entries for this paper.
Chen1995 C. H. Chen, T. J. Matthews, C. B. McDanal, D. P. Bolognesi, and M. L. Greenberg. A Molecular Clasp in the Human Immunodeficiency Virus (HIV) Type 1 TM Protein Determines the Anti-HIV Activity of gp41 Derivatives: Implication for Viral Fusion. J. Virol., 69:3771-3777, 1995. PubMed ID: 7538176. Show all entries for this paper.
Binley1996 J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976. Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Kalia2005 Vandana Kalia, Surojit Sarkar, Phalguni Gupta, and Ronald C. Montelaro. Antibody Neutralization Escape Mediated by Point Mutations in the Intracytoplasmic Tail of Human Immunodeficiency Virus Type 1 gp41. J. Virol., 79(4):2097-2107, Feb 2005. PubMed ID: 15681412. Show all entries for this paper.
Vincent2008 Nadine Vincent, Amadou Kone, Blandine Chanut, Frédéric Lucht, Christian Genin, and Etienne Malvoisin. Antibodies Purified from Sera of HIV-1-Infected Patients by Affinity on the Heptad Repeat Region 1/Heptad Repeat Region 2 Complex of gp41 Neutralize HIV-1 Primary Isolates. AIDS, 22(16):2075-2085, 18 Oct 2008. PubMed ID: 18832871. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab D5 (D5) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | D | |
Immunogen | HIV-1 infection | |
Keywords | ADCC, antibody binding site, antibody interactions, antibody lineage, antibody sequence, assay or method development, binding affinity, kinetics, mimics, neutralization, review, structure, subtype comparisons, vaccine antigen design, vaccine-induced immune responses, variant cross-reactivity |
Showing 22 of 22 notes.
Showing 22 of 22 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Balla-Jhagjhoorsingh2011 Sunita S. Balla-Jhagjhoorsingh, Betty Willems, Liesbeth Heyndrickx, Leo Heyndrickx, Katleen Vereecken, Wouter Janssens, Michael S. Seaman, Davide Corti, Antonio Lanzavecchia, David Davis, and Guido Vanham. Characterization of Neutralizing Profiles in HIV-1 Infected Patients from Whom the HJ16, HGN194 and HK20 mAbs Were Obtained. PLoS One, 6(10):e25488, 2011. PubMed ID: 22016769. Show all entries for this paper.
Bianchi2010 Elisabetta Bianchi, Joseph G. Joyce, Michael D. Miller, Adam C. Finnefrock, Xiaoping Liang, Marco Finotto, Paolo Ingallinella, Philip McKenna, Michael Citron, Elizabeth Ottinger, Robert W. Hepler, Renee Hrin, Deborah Nahas, Chengwei Wu, David Montefiori, John W. Shiver, Antonello Pessi, and Peter S. Kim. Vaccination with Peptide Mimetics of the gp41 Prehairpin Fusion Intermediate Yields Neutralizing Antisera against HIV-1 Isolates. Proc. Natl. Acad. Sci. U.S.A., 107(23):10655-10660, 8 Jun 2010. PubMed ID: 20483992. Show all entries for this paper.
Caulfield2010 Michael J. Caulfield, Vadim Y. Dudkin, Elizabeth A. Ottinger, Krista L. Getty, Paul D. Zuck, Robin M. Kaufhold, Robert W. Hepler, Georgia B. McGaughey, Michael Citron, Renee C. Hrin, Ying-Jie Wang, Michael D. Miller, and Joseph G. Joyce. Small Molecule Mimetics of an HIV-1 gp41 Fusion Intermediate As Vaccine Leads. J. Biol. Chem., 285(52):40604-40611, 24 Dec 2010. PubMed ID: 20943652. Show all entries for this paper.
DaSilva2010 Gustavo F. Da Silva, Joseph S. Harrison, and Jonathan R. Lai. Contribution of Light Chain Residues to High Affinity Binding in an HIV-1 Antibody Explored by Combinatorial Scanning Mutagenesis. Biochemistry, 49(26):5464-5472, 6 Jul 2010. PubMed ID: 20518570. Show all entries for this paper.
Eckert2008 Debra M. Eckert, Yu Shi, Sunghwan Kim, Brett D. Welch, Eunchai Kang, Emily S. Poff, and Michael S. Kay. Characterization of the Steric Defense of the HIV-1 gp41 N-Trimer Region. Protein Sci., 17(12):2091-2100, Dec 2008. PubMed ID: 18802030. Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
Gustchina2007 Elena Gustchina, John M. Louis, Son N. Lam, Carole A. Bewley, and G. Marius Clore. A Monoclonal Fab Derived from a Human Nonimmune Phage Library Reveals a New Epitope on gp41 and Neutralizes Diverse Human Immunodeficiency Virus Type 1 Strains. J. Virol., 81(23):12946-12953, Dec 2007. PubMed ID: 17898046. Show all entries for this paper.
Gustchina2010 Elena Gustchina, Mi Li, John M. Louis, D. Eric Anderson, John Lloyd, Christian Frisch, Carole A. Bewley, Alla Gustchina, Alexander Wlodawer, and G. Marius Clore. Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41. PLoS Pathog., 6(11):e1001182, 2010. PubMed ID: 21085615. Show all entries for this paper.
Hartono2012 Yossa Dwi Hartono, Raudah Lazim, Yew Mun Yip, and Dawei Zhang. Computational Study of Bindings of HK20 Fab and D5 Fab to HIV-1 gp41. Bioorg. Med. Chem. Lett., 22(4):1695-1700, 15 Feb 2012. PubMed ID: 22260771. Show all entries for this paper.
Hrin2008 Renee Hrin, Donna L. Montgomery, Fubao Wang, Jon H. Condra, Zhiqiang An, William R. Strohl, Elisabetta Bianchi, Antonello Pessi, Joseph G. Joyce, and Ying-Jie Wang. Short Communication: In Vitro Synergy between Peptides or Neutralizing Antibodies Targeting the N- and C-Terminal Heptad Repeats of HIV Type 1 gp41. AIDS Res. Hum. Retroviruses, 24(12):1537-1544, Dec 2008. PubMed ID: 19102685. Show all entries for this paper.
Klein2013 Florian Klein, Ron Diskin, Johannes F. Scheid, Christian Gaebler, Hugo Mouquet, Ivelin S. Georgiev, Marie Pancera, Tongqing Zhou, Reha-Baris Incesu, Brooks Zhongzheng Fu, Priyanthi N. P. Gnanapragasam, Thiago Y. Oliveira, Michael S. Seaman, Peter D. Kwong, Pamela J. Bjorkman, and Michel C. Nussenzweig. Somatic Mutations of the Immunoglobulin Framework Are Generally Required for Broad and Potent HIV-1 Neutralization. Cell, 153(1):126-138, 28 Mar 2013. PubMed ID: 23540694. Show all entries for this paper.
Kwong2009a Peter D. Kwong and Ian A. Wilson. HIV-1 and Influenza Antibodies: Seeing Antigens in New Ways. Nat. Immunol., 10(6):573-578, Jun 2009. PubMed ID: 19448659. Show all entries for this paper.
Kwong2011 Peter D. Kwong, John R. Mascola, and Gary J. Nabel. Rational Design of Vaccines to Elicit Broadly Neutralizing Antibodies to HIV-1. Cold Spring Harb. Perspect. Med., 1(1):a007278, Sep 2011. PubMed ID: 22229123. Show all entries for this paper.
Leaman2010 Daniel P. Leaman, Heather Kinkead, and Michael B. Zwick. In-Solution Virus Capture Assay Helps Deconstruct Heterogeneous Antibody Recognition of Human Immunodeficiency Virus Type 1. J. Virol., 84(7):3382-3395, Apr 2010. PubMed ID: 20089658. Show all entries for this paper.
Lin2007 George Lin and Peter L. Nara. Designing Immunogens to Elicit Broadly Neutralizing Antibodies to the HIV-1 Envelope Glycoprotein. Curr. HIV Res., 5(6):514-541, Nov 2007. PubMed ID: 18045109. Show all entries for this paper.
Pantophlet2010 Ralph Pantophlet. Antibody Epitope Exposure and Neutralization of HIV-1. Curr. Pharm. Des., 16(33):3729-3743, 2010. PubMed ID: 21128886. Show all entries for this paper.
Phogat2007 S. Phogat, R. T. Wyatt, and G. B. Karlsson Hedestam. Inhibition of HIV-1 Entry by Antibodies: Potential Viral and Cellular Targets. J. Intern. Med., 262(1):26-43, Jul 2007. PubMed ID: 17598813. Show all entries for this paper.
Sabin2010 Charles Sabin, Davide Corti, Victor Buzon, Mike S. Seaman, David Lutje Hulsik, Andreas Hinz, Fabrizia Vanzetta, Gloria Agatic, Chiara Silacci, Lara Mainetti, Gabriella Scarlatti, Federica Sallusto, Robin Weiss, Antonio Lanzavecchia, and Winfried Weissenhorn. Crystal Structure and Size-Dependent Neutralization Properties of HK20, a Human Monoclonal Antibody Binding to the Highly Conserved Heptad Repeat 1 of gp41. PLoS Pathog., 6(11):e1001195, 2010. PubMed ID: 21124990. Show all entries for this paper.
Vincent2012 Nadine Vincent and Etienne Malvoisin. Ability of Antibodies Specific to the HIV-1 Envelope Glycoprotein to Block the Fusion Inhibitor T20 in a Cell-Cell Fusion Assay. Immunobiology, 217(10):943-950, Oct 2012. PubMed ID: 22387075. Show all entries for this paper.
Yang2018 Zheng Yang, Xi Liu, Zehua Sun, Jingjing Li, Weiguo Tan, Weiye Yu, and Meiyun Zhang. Identification of a HIV gp41-Specific Human Monoclonal Antibody with Potent Antibody-Dependent Cellular Cytotoxicity. Front. Immunol., 9:2613, 2018. PubMed ID: 30519238. Show all entries for this paper.
Zhou2010 Tongqing Zhou, Ivelin Georgiev, Xueling Wu, Zhi-Yong Yang, Kaifan Dai, Andrés Finzi, Young Do Kwon, Johannes F. Scheid, Wei Shi, Ling Xu, Yongping Yang, Jiang Zhu, Michel C. Nussenzweig, Joseph Sodroski, Lawrence Shapiro, Gary J. Nabel, John R. Mascola, and Peter D. Kwong. Structural Basis for Broad and Potent Neutralization of HIV-1 by Antibody VRC01. Science, 329(5993):811-817, 13 Aug 2010. PubMed ID: 20616231. Show all entries for this paper.
Download this epitope record as JSON.
MAb ID | Fab D11 (D11) | |
---|---|---|
HXB2 Location | Env | Env Epitope Map |
Author Location | gp41( LAI) | |
Epitope |
|
|
Subtype | B | |
Ab Type | gp41 cluster II | |
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | D | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.