HIV molecular immunology database

 

Search Antibody Database

Found 1 matching record:

Displaying record number 906

Download this epitope record as JSON.

MAb ID 4H4
HXB2 Location Nef(1-33)
DNA(8797..8895)
Nef Epitope Map
Author Location Nef(1-33 IIIB)
Epitope MGGKWSKSSVVGWPTVRERMRRAPTVRERMRRAEPAADGVGAA Epitope Alignment
Ab Type  
Neutralizing  
Species (Isotype) human(IgG1)
Patient  
Immunogen vaccine
Keywords  

Vaccine Details

Vaccine type protein
Vaccine strain B clade IIIB
Vaccine component Nef

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Otake1994 K. Otake, Y. Fujii, Y. Nishino, Q. Zhong, K. Fujinaga, M. Kameoka, K. Ohki, and K. Ikuta. The Carboxyl-Terminal Region of HIV-1 Nef Protein Is a Cell Surface Domain That Can Interact with CD4+ T Cells. J. Immunol., 153:5826-5837, 1994. This study shows that the C-terminal end of Nef is accessible to Abs. This domain could bind in a soluble form to CD4+, uninfected cells, and this interaction is inhibited in the presence of the C-terminal specific antibodies. Syncytium formation was reduced by these Abs or peptides. Abs could stain IIIB/M10, but not MN/M10, infected cells, in a membrane immunofluorescence assay. PubMed ID: 7989778. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health