Search Antibody Database

Found 1 matching record:

Displaying record number 799

Download this epitope record as JSON.

MAb ID	41-1 (41.1, gp41-1)
HXB2 Location	gp160(579-608) DNA(7959..8048)	gp160 Epitope Map
Author Location	gp41(584-609 LAV)
Epitope	`RILAVERYLKDQQLLGIWGCSGKLICTTAV`	Epitope Alignment
Ab Type
Neutralizing
Species (Isotype)	mouse(IgG1κ)
Patient
Immunogen	vaccine
Keywords	antibody binding site, antibody generation

Vaccine Details

Vaccine type	protein
Vaccine component	gp160

Notes

Showing 7 of 7 notes.

41-1: Called 41.1, and described as a human MAb, binding 579-604 -- a panel of immunotoxins was generated by linking Env MAbs to ricin A -- immunotoxins mediated cell killing, but killing was not directly proportional to binding. Pincus1996
41-1: Did not require the C-C disulfide bridge and loop formation, can bind simultaneously with 9-11. MAb 4-1 is described as being raised against gp160 in mouse, cited to Dr K. Shriver, Genetic Systems Corp, Seattle WA (no published reference given, but Shriver was a coauthor of Gosting1987). Mani1994
41-1: Called 41.1, and described as a human MAb -- cross-competes with 41.4 -- sCD4 enhances the efficacy of immunotoxins in vitro 30-fold -- MAb was coupled to ricin A chain (RAC). Pincus1993
41-1: Described as mouse MAb 41.1 cited to Gostling1987. Efficacious as an immunotoxin when coupled to RAC -- gave linear epitope as gp160 579-603. Pincus1991
41-1: Broadly reactive. Gosting1987 (antibody binding site, antibody generation)
41-1 database comment: Also called 41.1, although possibly not, the literature is confusing because two gp41 MAbs that bind to this region with similar names (dash versus period) are listed as murine and human.
41-1 database comment: This antibody to gp41(584-609) Mani1994 seems to have been named the same as a different MAb to gp41(735-752 IIIB) Dalgleish1988.

References

Showing 7 of 7 references.

Isolation Paper
Gosting1987 L. H. Gosting, J. McClure, E. S. Dickinson, S. M. Watanabe, K. Shriver, and L. C. Goldstein. Monoclonal antibodies to gp110 and gp41 of human immunodeficiency virus. J. Clin. Microbiol., 25:845-848, 1987. PubMed ID: 2438302. Show all entries for this paper.

Thomas1988 E. Kinney Thomas, J. N. Weber, J. McClure, P. R. Clapham, M. C. Singhal, M. K. Shriver, and R. A. Weiss. Neutralizing Monoclonal Antibodies to the AIDS Virus. AIDS, 2:25-29, 1988. PubMed ID: 2451922. Show all entries for this paper.

Mani1994 J.-C. Mani, V. Marchi, and C. Cucurou. Effect of HIV-1 Peptide Presentation on the Affinity Constants of Two Monoclonal Antibodies Determined by BIAcore Technology. Mol. Immunol., 31:439-444, 1994. Two MAbs are described; one 41-1 did not require the Cys-Cys disulfide bridge and loop formation, the other 9-11 depends on loop formation. PubMed ID: 7514268. Show all entries for this paper.

Pincus1991 S. H. Pincus, R. L. Cole, E. M. Hersh, D. Lake, Y. Masuho, P. J. Durda, and J. McClure. In Vitro Efficacy of Anti-HIV Immunotoxins Targeted by Various Antibodies to the Envelope Protein. J. Immunol., 146:4315-4324, 1991. Six MAbs, (907, 924, 110.1, 41.1, 86 and P5-3) and polyclonal pooled serum antibodies purified on gp160 were coupled to RAC to create immunotoxins. Only 41.1-RAC, an anti-gp41 MAb-immunotoxin and the polyclonal immunotoxin showed direct activity against multiple strains, and activity of an immunotoxin was found not to be directly correlated with cell surface binding. PubMed ID: 1710247. Show all entries for this paper.

Pincus1993 S. H. Pincus and J. McClure. Soluble CD4 Enhances the Efficacy of Immunotoxins Directed against gp41 of the Human Immunodeficiency Virus. Proc. Natl. Acad. Sci. U.S.A., 90:332-336, 1993. PubMed ID: 8419938. Show all entries for this paper.

Pincus1996 S. H. Pincus, K. Wehrly, R. Cole, H. Fang, G. K. Lewis, J. McClure, A. J. Conley, B. Wahren, M. R. Posner, A. L. Notkins, S. A. Tilley, A. Pinter, L. Eiden, M. Teintze, D. Dorward, and V. V. Tolstikov. In Vitro Effects of Anti-HIV Immunotoxins Directed against Multiple Epitopes on HIV Type 1 Envelope Glycoprotein 160. AIDS Res. Hum. Retroviruses, 12:1041-1051, 1996. A panel of anti-gp160 MAbs to was used to construct anti-HIV immunotoxins by coupling antibodies to ricin A chain (RAC). The ability of the immunotoxins to kill HIV-1-infected cells was tested in tissue culture. Immunotoxins that bind epitopes on the cell surface killed infected cells, although killing was not directly proportional to binding. The activity of anti-gp41 immunotoxins was markedly enhanced in the presence of sCD4. PubMed ID: 8827220. Show all entries for this paper.

Pincus1998 S. H. Pincus, R. L. Cole, R. Watson-McKown, A. Pinter, W. Honnen, B. Cole, and K. S. Wise. Immunologic Cross-Reaction between HIV Type 1 p17 and Mycoplasma hyorhinis Variable Lipoprotein. AIDS Res. Hum. Retroviruses, 14:419-425, 1998. PubMed ID: 9546801. Show all entries for this paper.