HIV molecular immunology database

 

Search Antibody Database

Found 1 matching record:

Displaying record number 798

Download this epitope record as JSON.

MAb ID 41.4
HXB2 Location gp160(579-608)
DNA(7959..8048)
gp160 Epitope Map
Author Location gp41(584-609)
Research Contact Jan McClure, Bristol-Myers Squibb Pharmaceutical Res Inst, Seattle, WA
Epitope RILAVERYLKDQQLLGIWGCSGKLICTTAV Epitope Alignment
Ab Type  
Neutralizing  
Species (Isotype)  
Patient  
Immunogen  
Keywords  

Notes

Showing 1 of 1 note.

References

Showing 1 of 1 reference.

Pincus1993 S. H. Pincus and J. McClure. Soluble CD4 Enhances the Efficacy of Immunotoxins Directed against gp41 of the Human Immunodeficiency Virus. Proc. Natl. Acad. Sci. U.S.A., 90:332-336, 1993. PubMed ID: 8419938. Show all entries for this paper.


Questions or comments? Contact us at immuno@lanl.gov
 
Managed by Triad National Security, LLC for the U.S. Department of Energy’s National Nuclear Security Administration
Copyright © 2022 Triad National Security, LLC | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health