HIV molecular immunology database
Found 1 matching record:
Download this epitope record as JSON.
MAb ID | Fab A4 (A4) | |
---|---|---|
HXB2 Location | gp160(579-608) DNA(7959..8048) |
gp160 Epitope Map |
Author Location | gp41(584-609 LAI) | |
Epitope |
RILAVERYLKDQQLLGIWGCSGKLICTTAV
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | A | |
Immunogen | HIV-1 infection | |
Keywords | antibody binding site, antibody generation, antibody sequence, review |
Showing 2 of 2 notes.
Showing 2 of 2 references.
Isolation Paper
Binley1996
J. M. Binley, H. J. Ditzel, C. F. Barbas III, N. Sullivan, J. Sodroski, P. W. H. I. Parren, and D. R. Burton. Human Antibody Responses to HIV Type 1 Glycoprotein 41 Cloned in Phage Display Libraries Suggest Three Major Epitopes Are Recognized and Give Evidence for Conserved Antibody Motifs in Antigen Binding. AIDS Res. Hum. Retroviruses, 12:911-924, 1996. A panel of anti-gp41 human Fab fragments were generated by panning phage display antibody libraries prepared from HIV-1 positive donors with rgp41. Fabs tended to be directed against three epitopes, designated clusters I-III. None were neutralizing. A common CDR3 motif was found in several of the heavy chain sequences. PubMed ID: 8798976.
Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.