Search Antibody Database

Found 1 matching record:

Displaying record number 60

Download this epitope record as JSON.

MAb ID	polyclonal
HXB2 Location	Gag(253-284) DNA(1546..1641)	Gag Epitope Map
Author Location	Gag(253-284 LAI)
Epitope	`NPPIPVGEIYKRWIILGLNKIVRMYSPTSILD`	Epitope Alignment
Epitope Name	G2
Subtype	B
Ab Type
Neutralizing
Species (Isotype)	human(IgG)
Patient
Immunogen	vaccine
Keywords

Vaccine Details

Vaccine type	lipopeptide
Vaccine strain	B clade LAI
Vaccine component	p24 Gag
Adjuvant	QS21

Notes

Showing 1 of 1 note.

28 subjects were vaccinated with six HIV-1 peptides that were selected to be particularly rich in CTL epitopes, presented in lipopeptides with or without adjuvant QS21 -- HIV-specific Ab responses were detected in 25/28 (89%), proliferative in 19/28 (79%), and CTL in 13/24 (54%) of testable volunteers -- 25/28 had Ab responses to peptide G2, 14/28 had proliferative responses, and CTL responses were detected. Pialoux2001

References

Showing 1 of 1 reference.

Pialoux2001 G. Pialoux, H. Gahery-Segard, S. Sermet, H. Poncelet, S. Fournier, L. Gerard, A. Tartar, H. Gras-Masse, J. P. Levy, J. G. Guillet, and \ANRS VAC 04 Study Team.\. Lipopeptides induce cell-mediated anti-HIV immune responses in seronegative volunteers. AIDS, 15(10):1239-49, 6 Jul 2001. PubMed ID: 11426068. Show all entries for this paper.