HIV molecular immunology database
Found 1 matching record:
Download this epitope record as JSON.
MAb ID | polyclonal | |
---|---|---|
HXB2 Location | Gag(183-214) DNA(1336..1431) |
Gag Epitope Map |
Author Location | Gag(183-214 LAI) | |
Epitope |
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDR
|
Epitope Alignment |
Epitope Name | G1 | |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | lipopeptide |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | p24 Gag |
Adjuvant | QS21 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Pialoux2001 G. Pialoux, H. Gahery-Segard, S. Sermet, H. Poncelet, S. Fournier, L. Gerard, A. Tartar, H. Gras-Masse, J. P. Levy, J. G. Guillet, and \ANRS VAC 04 Study Team.\. Lipopeptides induce cell-mediated anti-HIV immune responses in seronegative volunteers. AIDS, 15(10):1239-49, 6 Jul 2001. PubMed ID: 11426068. Show all entries for this paper.