HIV molecular immunology database
Found 1 matching record:
Download this epitope record as JSON.
MAb ID | D/6D1 | |
---|---|---|
HXB2 Location | gp160(346-377) DNA(7260..7355) |
gp160 Epitope Map |
Author Location | gp120(351-382 LAI) | |
Epitope |
ASKLREQFGNNKTIIFKQSSGGDPEIVTHSFN
|
Epitope Alignment |
Subtype | B | |
Ab Type | gp120 V4 | |
Neutralizing | ||
Species (Isotype) | mouse(IgG1) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine strain | B clade LAI |
Vaccine component | gp120 |
Showing 1 of 1 note.
Showing 1 of 1 reference.
Bristow1994 R. G. W. Bristow, A. R. Douglas, J. J. Skehel, and R. S Daniels. Analysis of murine antibody responses to baculovirus-expressed human immunodeficiency virus type 1 envelope glycoproteins. J. Gen. Virol., 75:2089-2095, 1994. BALB/c mice were immunized with baculovirus expressed gp160 or gp120, and 15 MAbs were generated. No MAbs generated in this study neutralized reference strains, using a tetrazolium-based cytotoxicity assay to test for neutralization. Ten of the Mabs were mapped by peptide ELISA, and seven reacted with the C1 region, one with V2, one with V4, and one with the C-terminal end. PubMed ID: 7519249. Show all entries for this paper.