Search Antibody Database

Found 1 matching record:

Displaying record number 1032

Download this epitope record as JSON.

MAb ID	polyclonal
HXB2 Location	Nef(119-168) DNA(9151..9300)	Nef Epitope Map
Author Location	Nef(118-167 LAI, BRU)
Epitope	`GYFPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPV`	Epitope Alignment
Epitope Name	PF15
Subtype	B
Ab Type
Neutralizing
Species (Isotype)	mouse(IgG1)
Patient
Immunogen	HIV-1 infection, vaccine
Keywords

Vaccine Details

Vaccine type	protein, PLG microparticle
Vaccine strain	B clade BRU, B clade LAI
Vaccine component	Nef
Adjuvant	Complete Freund's Adjuvant (CFA), PLG

Notes

Showing 2 of 2 notes.

This epitope is similar to a fragment of the human protein Bone-derived growth factor, PLEPAKLEE, and to Hematopoietic progenitor cell antigen CD34, TSLHPVSQHG. Maksiutov2002
Nef encapsulated in poly(DL-lactide-co-glycolide) (PLG) had a more prolonged Ab response than Nef in PBS or in Freund's adjuvant (CFA), still strong after 7 months -- the response was predominantly IgG1, a Th2 immune response -- three linear epitopes, Nef 32-64, 118-167, and 185-205, were frequently recognized by the sera of mice immunized with NefPLG or Nef-CFA, but not after immunization with Nef in PBS, which seemed to preferentially stimulate an Ab response to conformational epitopes. Moureau2002

References

Showing 2 of 2 references.

Moureau2002 Corinne Moureau, Pierre-Louis Vidal, Yamina Bennasser, Marinette Moynier, Yvan Nicaise, Muriel Aussillous, Sophie Barthelemy, Luc Montagnier, and Elmostafa Bahraoui. Characterization of Humoral and Cellular Immune Responses in Mice Induced by Immunization with HIV-1 Nef Regulatory Protein Encapsulated In Poly(DL-Lactide-Co-Glycolide) Microparticles. Mol. Immunol., 38(8):607-618, Jan 2002. PubMed ID: 11792429. Show all entries for this paper.

Maksiutov2002 A. Z. Maksiutov, A. G. Bachinskii, and S. I. Bazhan. [Searching for Local Similarities Between HIV-1 and Human Proteins. Application to Vaccines]. Mol Biol (Mosk), 36(3):447-459, May-Jun 2002. Article in Russian. PubMed ID: 12068630. Show all entries for this paper.