HIV molecular immunology database
Found 1 matching record:
Download this epitope record as JSON.
MAb ID | 30:3E5 | |
---|---|---|
HXB2 Location | Gag(273-302) DNA(1606..1695) |
Gag Epitope Map |
Author Location | p24(273-302 HXB2) | |
Research Contact | B. Wahren | |
Epitope |
IVRMYSPTSILDIRQGPKEPFRDYVDRFYK
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | mouse(IgG1λ) | |
Patient | ||
Immunogen | vaccine | |
Keywords |
Vaccine type | protein |
---|---|
Vaccine component | p24-p15 Gag |
Showing 2 of 2 notes.
Showing 1 of 1 references.
Hinkula1990 J. Hinkula, J. Rosen, V.-A. Sundqvist, T. Stigbrand, and B. Wahren. Epitope Mapping of the HIV-1 Gag Region with Monoclonal Antibodies. Mol. Immunol., 27:395-403, 1990. Localization of immunogenic domains in p24, p17, and p15. PubMed ID: 1694957. Show all entries for this paper.