HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIVU96576		     615 bp    DNA     linear	VRL 17-JAN-1998
DEFINITION  HIV-1 patient MA population variant MAX30 from USA, envelope
	    glycoprotein, C2-V5 region (env) gene, partial cds
ACCESSION   U96576
VERSION     U96576.1 GI:2190880
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 615)
            Show all sequences for reference 1
  AUTHORS   Delwart,E.L., Mullins,J.I., Gupta,P., Learn,G.H. Jr.., Holodniy,M.,
	    Katzenstein,D., Walker,B.D. and Singh,M.K.
  TITLE     Human immunodeficiency virus type 1 populations in blood and semen
  JOURNAL   J. Virol. 72 (1), 617-623 (1998)
  PUBMED    9420266
REFERENCE   2 (bases 1 to 615)
            Show all sequences for reference 2
  AUTHORS   Delwart,E.L., Singh,M., Gupta,P., Learn,G.H. Jr.., Holodniy,M.,
	    Katzenstein,D., Walker,B.D. and Mullins,J.I.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-1997) Aaron Diamond AIDS Research Center, 455
	    First Ave., New York, NY 10016, USA
COMMENT     These sequences from patient MA (U96571-U96578) were taken at ~6
	    years post-infection and 9 months after start of AZT; based on data
	    for this patient in other papers, this puts the sampling date at
	    January 1990 [JM 12/08].
FEATURES             Location/Qualifiers
     source	     1..615
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="patient MA"
		     /db_xref="taxon:11676"
		     /pop_variant="MAX30"
		     /note="nonspermatozoal mononuclear cell"
     gene	     <1..>615
		     /gene="env"
     CDS	     <1..>615
		     /gene="env"
		     /note="SU glycoprotein, gp120; C2-V5 region"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAC40422.1"
		     /db_xref="GI:2190881"
		     /translation="EEEVVIRSENFTENHKIIIVQLKEPVEINCTRPGNNTRKSIPMG
		     PGRAWFATGDIIGDIRKAHCNISRAKWNNTLEQVVKKLGEQFRNKTIIFNQHSGGDPE
		     IVMHSFNCGGEFFYCNTTQLFNSTWNNGTWNFTGTEGNSTIITLQCRIKQFINLWQKV
		     GKAMYAPPIQGNISCSSNITGLLLTRDGGNESKPNETFRPGGGDM"
BASE COUNT	250 a	  95 c	  130 g    140 t
ORIGIN
       1 gaagaagagg tagtaattag atctgaaaat ttcacggaaa atcataaaat cataatagta 
      61 cagctgaaag aacctgtaga aattaattgc acaagacccg gcaacaatac aagaaaaagt 
     121 atacctatgg gaccagggag agcatggttt gcaacaggag acataatagg agatataaga 
     181 aaagcacatt gtaacattag tagagcaaaa tggaataaca ctttggaaca ggtagttaaa 
     241 aaattaggag aacaatttag gaataaaaca ataatcttta atcaacactc aggaggggac 
     301 ccagaaattg taatgcacag ctttaattgt ggaggggaat ttttctactg taatacaaca 
     361 caactgttta atagtacttg gaataatggt acttggaatt ttactggaac tgaaggaaat 
     421 agcacaataa tcacactcca atgcagaata aaacaattta taaacctgtg gcagaaagta 
     481 ggaaaagcaa tgtatgcccc tcccatccaa ggaaatatta gctgttcatc aaatattaca 
     541 gggctgctat taacaagaga tggtggtaac gagagcaagc ccaacgagac cttcagacct 
     601 ggaggaggag atatg
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health