HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIVU56871		     648 bp    DNA     linear	VRL 27-MAR-1998
DEFINITION  Human immunodeficiency virus type 1 envelope glycoprotein (env)
	    gene, C2 to V5 binding region, partial cds
ACCESSION   U56871
VERSION     U56871.1 GI:2384508
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 648)
            Show all sequences for reference 1
  AUTHORS   Wei,Q. and Fultz,P.N.
  TITLE     Extensive diversification of human immunodeficiency virus type 1
	    subtype B strains during dual infection of a chimpanzee that
	    progressed to AIDS
  JOURNAL   J. Virol. 72 (4), 3005-3017 (1998)
  PUBMED    9525623
REFERENCE   2 (bases 1 to 648)
            Show all sequences for reference 2
  AUTHORS   Fultz,P.N. and Wei,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-APR-1996) Patricia N. Fultz, Microbiology, University
	    of Alabama at Birmingham, 845 19th Street South, Birmingham, AL
	    35294, USA
REFERENCE   3 (bases 1 to 648)
            Show all sequences for reference 3
  AUTHORS   Fultz,P.N. and Wei,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-1997) Patricia N. Fultz, Microbiology, University
	    of Alabama at Birmingham, 845 19th Street South, Birmingham, AL
	    35294, USA
COMMENT     Sequence from chimpanzee C499 infected with strains SF2 and LAI. On
	    Sep 9, 1997 this sequence version replaced gi:1517953 in GenBank.
	    HIV-db sequence updated Jan 2006.
FEATURES             Location/Qualifiers
     source	     1..648
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /strain="LAI"
		     /db_xref="taxon:11676"
		     /clone="8c"
     gene	     <1..>648
		     /gene="env"
     CDS	     <1..>648
		     /gene="env"
		     /note="C2 to V5 binding region"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAC59281.1"
		     /db_xref="GI:2384509"
		     /translation="QLLLNGSLAEEEVVLRSANFTNNAKTIIVQLNHSVEITCTRPNY
		     NETKRIRIHRGYGRSFVTVRKLGDRKQAHCTMNGTKWDNALKQIANKLREQFNKTTII
		     FNRPSGGDLEIEMHSFNCGGELFYCNSTKLFNSTWNDTTESSGNGENITLPCRIRQFV
		     NMWQKVGKAMYAPPSDGQIKCSSNITGLLLTRDGGQNNNHNETFRPGGGDMRDNWR"
BASE COUNT	258 a	 112 c	  132 g    146 t
ORIGIN
       1 caactgctgt taaatggcag tctagcagaa gaagaggtag tacttagatc tgccaatttc 
      61 acaaacaatg ctaaaaccat aatagtacag ctgaaccact ctgtagaaat tacttgtaca 
     121 agacccaact acaatgaaac aaaaagaatc cgtatccaca gaggatatgg aagatcattt 
     181 gttacagtaa gaaaattggg agataggaaa caagcacatt gtaccatgaa tggaacaaaa 
     241 tgggacaacg ctttaaaaca gatagctaac aaattaagag aacaatttaa taaaacaaca 
     301 ataatcttta accggccctc aggtggagac ctagaaattg aaatgcacag ttttaattgt 
     361 ggaggggaat tgttctactg taactcaaca aaactgttta atagtacttg gaatgatact 
     421 acagagtcaa gtggcaatgg agaaaatatc acactcccat gcagaataag acaatttgta 
     481 aacatgtggc agaaagtagg aaaagcaatg tatgcccctc ccagcgatgg acaaattaaa 
     541 tgttcatcaa atattactgg gctactatta acaagagatg gtggtcagaa caacaatcac 
     601 aacgagacct tcagacctgg aggaggagat atgagggaca attggaga
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health