View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVU56871 648 bp DNA linear VRL 27-MAR-1998
DEFINITION Human immunodeficiency virus type 1 envelope glycoprotein (env)
gene, C2 to V5 binding region, partial cds
ACCESSION U56871
VERSION U56871.1 GI:2384508
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 648)
Show all sequences for reference 1
AUTHORS Wei,Q. and Fultz,P.N.
TITLE Extensive diversification of human immunodeficiency virus type 1
subtype B strains during dual infection of a chimpanzee that
progressed to AIDS
JOURNAL J. Virol. 72 (4), 3005-3017 (1998)
PUBMED 9525623
REFERENCE 2 (bases 1 to 648)
Show all sequences for reference 2
AUTHORS Fultz,P.N. and Wei,Q.
TITLE Direct Submission
JOURNAL Submitted (29-APR-1996) Patricia N. Fultz, Microbiology, University
of Alabama at Birmingham, 845 19th Street South, Birmingham, AL
35294, USA
REFERENCE 3 (bases 1 to 648)
Show all sequences for reference 3
AUTHORS Fultz,P.N. and Wei,Q.
TITLE Direct Submission
JOURNAL Submitted (09-SEP-1997) Patricia N. Fultz, Microbiology, University
of Alabama at Birmingham, 845 19th Street South, Birmingham, AL
35294, USA
COMMENT Sequence from chimpanzee C499 infected with strains SF2 and LAI. On
Sep 9, 1997 this sequence version replaced gi:1517953 in GenBank.
HIV-db sequence updated Jan 2006.
FEATURES Location/Qualifiers
source 1..648
/organism="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/strain="LAI"
/db_xref="taxon:11676"
/clone="8c"
gene <1..>648
/gene="env"
CDS <1..>648
/gene="env"
/note="C2 to V5 binding region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAC59281.1"
/db_xref="GI:2384509"
/translation="QLLLNGSLAEEEVVLRSANFTNNAKTIIVQLNHSVEITCTRPNY
NETKRIRIHRGYGRSFVTVRKLGDRKQAHCTMNGTKWDNALKQIANKLREQFNKTTII
FNRPSGGDLEIEMHSFNCGGELFYCNSTKLFNSTWNDTTESSGNGENITLPCRIRQFV
NMWQKVGKAMYAPPSDGQIKCSSNITGLLLTRDGGQNNNHNETFRPGGGDMRDNWR"
BASE COUNT 258 a 112 c 132 g 146 t
ORIGIN
1 caactgctgt taaatggcag tctagcagaa gaagaggtag tacttagatc tgccaatttc
61 acaaacaatg ctaaaaccat aatagtacag ctgaaccact ctgtagaaat tacttgtaca
121 agacccaact acaatgaaac aaaaagaatc cgtatccaca gaggatatgg aagatcattt
181 gttacagtaa gaaaattggg agataggaaa caagcacatt gtaccatgaa tggaacaaaa
241 tgggacaacg ctttaaaaca gatagctaac aaattaagag aacaatttaa taaaacaaca
301 ataatcttta accggccctc aggtggagac ctagaaattg aaatgcacag ttttaattgt
361 ggaggggaat tgttctactg taactcaaca aaactgttta atagtacttg gaatgatact
421 acagagtcaa gtggcaatgg agaaaatatc acactcccat gcagaataag acaatttgta
481 aacatgtggc agaaagtagg aaaagcaatg tatgcccctc ccagcgatgg acaaattaaa
541 tgttcatcaa atattactgg gctactatta acaagagatg gtggtcagaa caacaatcac
601 aacgagacct tcagacctgg aggaggagat atgagggaca attggaga
//
last modified: Tue May 31 10:56 2022