HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIVU50815		     651 bp    DNA     linear	VRL 09-MAY-1996
DEFINITION  Human immunodeficiency virus type 1 GP120 gene, V1 to V5 region,
	    partial cds
ACCESSION   U50815
VERSION     U50815.1 GI:1314517
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 651)
            Show all sequences for reference 1
  AUTHORS   Zhu,T., Wang,N., Carr,A., Nam,D.S., Moor-Jankowski,R., Cooper,D.A.
	    and Ho,D.D.
  TITLE     Genetic characterization of human immunodeficiency virus type 1 in
	    blood and genital secretions: evidence for viral
	    compartmentalization and selection during sexual transmission
  JOURNAL   J. Virol. 70 (5), 3098-3107 (1996)
  PUBMED    8627789
REFERENCE   2 (bases 1 to 651)
            Show all sequences for reference 2
  AUTHORS   Zhu,T., Wang,N., Car,A., Nam,D.S., Moor-Jankowski,R., Cooper,D.A.
	    and Ho,D.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAR-1996) Tuofu Zhu, The Aaron Diamond AIDS Research
	    Center for City of New York, 455 First Avenue, 7th Floor, New York,
	    NY 10016, USA
COMMENT     DNA extracted from plasma of a symptomatic male AIDS patient, AD38.
	    Sequences spanned by primers PE1 and P2 from the gp120 gene were
	    expanded by PCR amplification. A second round of PCR amplification
	    expanded V1-V2 sequences (using inner primers P1 and P10) and V3
	    (using inner primers P5 and PV3). AD38PL10 has been characterized
	    as non-syncytium inducing (NSI).
FEATURES             Location/Qualifiers
     source	     1..651
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /strain="AD38PL10"
		     /db_xref="taxon:11676"
     CDS	     <1..>636
		     /codon_start="1"
		     /transl_table="1"
		     /product="GP120, V1 to V5 region"
		     /protein_id="AAC54806.1"
		     /db_xref="GI:1314518"
		     /translation="VSTQLLLNGSLAEEEIVIRSANFSDNTKSIIVQLKEPVEINCTR
		     PNNNTIKGIHIGPGRAFYATGQIVGDIRQAHCNISKTKWNNTLQQIVSKLGEQFNKTI
		     IFNQSSGGDPEIVMHSFNCRGEFFYCNTTQLFNSTWKLVNGTWNVTDGLNNTEGNITL
		     PCRIKQIVNMWQEVGKAMYAPPIEGLIRCSSNITGLILTRDGGGNSSVNETF"
BASE COUNT	262 a	  99 c	  133 g    157 t
ORIGIN
       1 gtatcaactc aattgctgtt aaatggcagc ctagcagaag aagagatagt aattagatct 
      61 gccaatttct cagacaatac taaaagcata atagtacagc tgaaagaacc agtagaaatt 
     121 aattgtacaa gacccaacaa caatacaata aaaggtatac atataggacc agggagagca 
     181 ttttatgcaa caggacaaat agtaggagat ataagacaag cacattgtaa tattagtaaa 
     241 acaaaatgga ataacacttt acaacagata gttagcaaac taggagaaca atttaataaa 
     301 acaataatct ttaatcaatc ctcaggaggg gacccagaaa ttgtaatgca cagttttaat 
     361 tgcagagggg aatttttcta ctgtaataca acacaactgt ttaatagtac ttggaaactg 
     421 gttaatggta cttggaatgt tactgatggg ttaaacaaca cagaaggaaa tatcacactc 
     481 ccatgcagaa taaaacaaat tgtaaacatg tggcaggaag taggaaaagc aatgtatgct 
     541 cctcctatcg aaggactaat tagatgttca tcaaatatta cagggctgat attgacaaga 
     601 gatggtggag ggaacagtag cgtgaatgag acctttagac ctggaggagg a
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health