View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U24804 275 bp DNA linear VRL 21-APR-1995
DEFINITION Human immunodeficiency virus type 1 envelope glycoprotein (env)
gene, V3 region, clone sCbu4.13, partial cds
ACCESSION U24804
VERSION U24804.1 GI:818402
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 275)
Show all sequences for reference 1
AUTHORS Briant,L., Wade,C.M., Puel,J., Brown,A.J. and Guyader,M.
TITLE Analysis of envelope sequence variants suggests multiple mechanisms
of mother-to-child transmission of human immunodeficiency virus
type 1
JOURNAL J. Virol. 69 (6), 3778-3788 (1995)
PUBMED 7745725
REFERENCE 2 (bases 1 to 275)
Show all sequences for reference 2
AUTHORS Briant,L., Wade,C.M., Puel,J., Leigh Brown,A.J. and Guyader,M.
TITLE Direct Submission
JOURNAL Submitted (05-APR-1995) Chris M. Wade, Centre for HIV Research,
ICAPB, Division of Biological Sciences, University of Edinburgh,
King''s Buildings, West Mains Road, Edinburgh, EH9 3JN, Scotland,
United Kingdom
COMMENT B_FR1.ID These 4 sequences are from Toulouse, France. In this
study, 4 mother-infant pairs were followed during pregnancy and
after birth. The inter- and intra-patient sequence similarities of
this set of 308 sequences has been controversial, because some
infant sequences were identical to sequences from other mothers.
For purposes of this V3 section, only one sequence from each of the
4 infants is presented here. (Briant95), (Korber95) and (Learn96).
GenBank entries for all 308 sequences are found with accession
numbers U24717-U24999 and U25001-U25025
FEATURES Location/Qualifiers
source 1..275
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="Child A: 16 months"
/db_xref="taxon:11676"
/clone="sCbu4.13"
gene 1..275
/gene="env"
CDS <1..>275
/gene="env"
/codon_start="2"
/transl_table="1"
/product="envelope glycoprotein, V3 region"
/protein_id="AAC54076.1"
/db_xref="GI:818403"
/translation="TNNAKSIIVQLNETVEINCTRPNNNTRRGIHIGPGRAFYATGDI
IGNIRQAHCNISRAKWNDTLRQIAIKLGEQFKNKTIAFNQSSGGDPE"
BASE COUNT 127 a 42 c 50 g 56 t
ORIGIN
1 cacaaacaat gctaaaagca taatagtaca gctgaatgaa actgtagaaa ttaattgtac
61 aagacccaac aacaatacaa gaagaggtat acatatagga ccaggcagag cattttatgc
121 aacaggagat ataataggaa atataagaca agcacattgt aacattagta gagcaaaatg
181 gaatgacact ttaagacaga tagctataaa attaggagaa caatttaaga ataaaacaat
241 agcctttaat caatcctcag gaggggaccc agaaa
//
last modified: Tue May 31 10:56 2022