HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIV1U24804		     275 bp    DNA     linear	VRL 21-APR-1995
DEFINITION  Human immunodeficiency virus type 1 envelope glycoprotein (env)
	    gene, V3 region, clone sCbu4.13, partial cds
ACCESSION   U24804
VERSION     U24804.1 GI:818402
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 275)
            Show all sequences for reference 1
  AUTHORS   Briant,L., Wade,C.M., Puel,J., Brown,A.J. and Guyader,M.
  TITLE     Analysis of envelope sequence variants suggests multiple mechanisms
	    of mother-to-child transmission of human immunodeficiency virus
	    type 1
  JOURNAL   J. Virol. 69 (6), 3778-3788 (1995)
  PUBMED    7745725
REFERENCE   2 (bases 1 to 275)
            Show all sequences for reference 2
  AUTHORS   Briant,L., Wade,C.M., Puel,J., Leigh Brown,A.J. and Guyader,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-1995) Chris M. Wade, Centre for HIV Research,
	    ICAPB, Division of Biological Sciences, University of Edinburgh,
	    King''s Buildings, West Mains Road, Edinburgh, EH9 3JN, Scotland,
	    United Kingdom
COMMENT     B_FR1.ID These 4 sequences are from Toulouse, France. In this
	    study, 4 mother-infant pairs were followed during pregnancy and
	    after birth. The inter- and intra-patient sequence similarities of
	    this set of 308 sequences has been controversial, because some
	    infant sequences were identical to sequences from other mothers.
	    For purposes of this V3 section, only one sequence from each of the
	    4 infants is presented here. (Briant95), (Korber95) and (Learn96).
	    GenBank entries for all 308 sequences are found with accession
	    numbers U24717-U24999 and U25001-U25025
FEATURES             Location/Qualifiers
     source	     1..275
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="Child A: 16 months"
		     /db_xref="taxon:11676"
		     /clone="sCbu4.13"
     gene	     1..275
		     /gene="env"
     CDS	     <1..>275
		     /gene="env"
		     /codon_start="2"
		     /transl_table="1"
		     /product="envelope glycoprotein, V3 region"
		     /protein_id="AAC54076.1"
		     /db_xref="GI:818403"
		     /translation="TNNAKSIIVQLNETVEINCTRPNNNTRRGIHIGPGRAFYATGDI
		     IGNIRQAHCNISRAKWNDTLRQIAIKLGEQFKNKTIAFNQSSGGDPE"
BASE COUNT	127 a	  42 c	   50 g     56 t
ORIGIN
       1 cacaaacaat gctaaaagca taatagtaca gctgaatgaa actgtagaaa ttaattgtac 
      61 aagacccaac aacaatacaa gaagaggtat acatatagga ccaggcagag cattttatgc 
     121 aacaggagat ataataggaa atataagaca agcacattgt aacattagta gagcaaaatg 
     181 gaatgacact ttaagacaga tagctataaa attaggagaa caatttaaga ataaaacaat 
     241 agcctttaat caatcctcag gaggggaccc agaaa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health