View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U24792 237 bp DNA linear VRL 03-SEP-1996
DEFINITION Human immunodeficiency virus type 1 envelope glycoprotein (env)
gene, V3 region, clone sCbu3.19, partial cds
ACCESSION U24792
VERSION U24792.1 GI:818378
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 237)
Show all sequences for reference 1
AUTHORS Briant,L., Wade,C.M., Puel,J., Brown,A.J. and Guyader,M.
TITLE Analysis of envelope sequence variants suggests multiple mechanisms
of mother-to-child transmission of human immunodeficiency virus
type 1
JOURNAL J. Virol. 69 (6), 3778-3788 (1995)
PUBMED 7745725
REFERENCE 2 (bases 1 to 237)
Show all sequences for reference 2
AUTHORS Briant,L., Wade,C.M., Puel,J., Leigh Brown,A.J. and Guyader,M.
TITLE Direct Submission
JOURNAL Submitted (05-APR-1995) Chris M. Wade, Centre for HIV Research,
ICAPB, Division of Biological Sciences, University of Edinburgh,
King''s Buildings, West Mains Road, Edinburgh, EH9 3JN, Scotland,
United Kingdom
COMMENT V3-ID: B_FR1.ID These 4 sequences are from Toulouse, France. In
this study, 4 mother-infant pairs were followed during pregnancy
and after birth. The inter- and intra-patient sequence similarities
of this set of 308 sequences has been controversial, because some
infant sequences were identical to sequences from other mothers.
For purposes of this V3 section, only one sequence from each of the
4 infants is presented here. (Briant95), (Korber95) and (Learn96).
GenBank entries for all 308 sequences are found with accession
numbers U24717-U24999 and U25001-U25025
FEATURES Location/Qualifiers
source 1..237
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="Child A: 2.5 months"
/db_xref="taxon:11676"
/clone="sCbu3.19"
gene 1..237
/gene="env"
CDS <1..>237
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein, V3 region"
/protein_id="AAB07218.1"
/db_xref="GI:818379"
/translation="RSENITNNAKTIIVQLKESVEINCTRLSNNTRRSINIGPGRAFY
TTGAIIGDIRQAHCNISRVKWNNTLKQIVEKLGDQ"
BASE COUNT 111 a 29 c 44 g 53 t
ORIGIN
1 aggtctgaaa atatcacgaa taatgctaaa accataatag tacagctgaa agaatctgta
61 gaaattaatt gtacaagact cagcaataat acaagaagaa gtataaatat aggaccaggg
121 agagcatttt atacaacagg agctataata ggagatataa gacaagcaca ttgtaacatt
181 agtagagtaa aatggaataa cactttaaaa cagatagttg aaaaattagg agaccaa
//
last modified: Tue May 31 10:56 2022