View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U24786 319 bp DNA linear VRL 03-SEP-1996
DEFINITION Human immunodeficiency virus type 1 envelope glycoprotein (env)
gene, V3 region, clone Cbu3.9, partial cds
ACCESSION U24786
VERSION U24786.1 GI:818366
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 319)
Show all sequences for reference 1
AUTHORS Briant,L., Wade,C.M., Puel,J., Brown,A.J. and Guyader,M.
TITLE Analysis of envelope sequence variants suggests multiple mechanisms
of mother-to-child transmission of human immunodeficiency virus
type 1
JOURNAL J. Virol. 69 (6), 3778-3788 (1995)
PUBMED 7745725
REFERENCE 2 (bases 1 to 319)
Show all sequences for reference 2
AUTHORS Briant,L., Wade,C.M., Puel,J., Leigh Brown,A.J. and Guyader,M.
TITLE Direct Submission
JOURNAL Submitted (05-APR-1995) Chris M. Wade, Centre for HIV Research,
ICAPB, Division of Biological Sciences, University of Edinburgh,
King''s Buildings, West Mains Road, Edinburgh, EH9 3JN, Scotland,
United Kingdom
COMMENT V3-ID: B_FR1.ID These 4 sequences are from Toulouse, France. In
this study, 4 mother-infant pairs were followed during pregnancy
and after birth. The inter- and intra-patient sequence similarities
of this set of 308 sequences has been controversial, because some
infant sequences were identical to sequences from other mothers.
For purposes of this V3 section, only one sequence from each of the
4 infants is presented here. (Briant95), (Korber95) and (Learn96).
GenBank entries for all 308 sequences are found with accession
numbers U24717-U24999 and U25001-U25025
FEATURES Location/Qualifiers
source 1..319
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="Child A: 2.5 months"
/db_xref="taxon:11676"
/clone="Cbu3.9"
gene 1..319
/gene="env"
CDS <1..>319
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein, V3 region"
/protein_id="AAB07212.1"
/db_xref="GI:818367"
/translation="GSLAEEEVVIRSENFTNNAKTIIVQLKESVEINCTRLSNNTRRS
INIGPGRAFYTTGAIIGDIRQAHCNISRVKWNNTLKQIVEKLGDQFKNKTIVFTQSSG
GDPE"
BASE COUNT 141 a 42 c 64 g 72 t
ORIGIN
1 ggcagtctag cggaagaaga ggtagtaatt aggtctgaaa atttcacgaa taatgctaaa
61 accataatag tacagctgaa agaatctgta gaaattaatt gtacaagact cagcaataat
121 acaagaagaa gtataaatat aggaccaggg agagcatttt atacaacagg agctataata
181 ggagatataa gacaagcaca ttgtaacatt agtagagtaa aatggaataa cactttaaaa
241 cagatagttg aaaaattagg agaccaattt aagaataaaa caatagtctt tactcaatcc
301 tcaggagggg acccagaaa
//
last modified: Tue May 31 10:56 2022