HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIVP19RT02		     117 bp    DNA     linear	VRL 15-OCT-1996
DEFINITION  Human immunodeficiency virus type 1 isolate P19 reverse
	    transcriptase (pol) gene, 3' region, partial cds
ACCESSION   U14859
VERSION     U14859.1 GI:887711
KEYWORDS    .
SEGMENT     2 of 2
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 117)
            Show all sequences for reference 1
  AUTHORS   Najera,I., Holguin,A., Quinones-Mateu,M.E., Munoz-Fernandez,M.A.,
	    Najera,R., Lopez-Galindez,C. and Domingo,E.
  TITLE     Pol gene quasispecies of human immunodeficiency virus: mutations
	    associated with drug resistance in virus from patients undergoing
	    no drug therapy
  JOURNAL   J. Virol. 69 (1), 23-31 (1995)
  PUBMED    7983713
REFERENCE   2 (bases 1 to 117)
            Show all sequences for reference 2
  AUTHORS   Quinones-Mateu,M.E., Holguin,A., Dopazo,J., Najera,I. and
	    Domingo,E.
  TITLE     Point mutant frequencies in the pol gene of human immunodeficiency
	    virus type 1 are two- to threefold lower than those of env
  JOURNAL   AIDS Res. Hum. Retroviruses 12 (12), 1117-1128 (1996)
  PUBMED    8844016
REFERENCE   3 (bases 1 to 117)
            Show all sequences for reference 3
  AUTHORS   Quinones-Mateu,M.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-1994) Miguel E. Quinones-Mateu, Centro de
	    Biologia Molecular ''Severo Ochoa'', Universidad Autonoma de
	    Madrid, Cantoblanco, Madrid, 28049, Spain
COMMENT     On Jul 6, 1995 this sequence version replaced gi:608348.
FEATURES             Location/Qualifiers
     source	     1..117
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="P19"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /cell_type="peripheral blood lymphocytes"
     gene	     join(U14858.1:1..204,1..117)
		     /gene="pol"
     CDS	     <1..>117
		     /gene="pol"
		     /note="similar to pol polyprotein encoded by GenBank
		     Accession Numbers X71115 and D10112; these residues
		     correspond to amino acid residues 181 to 219 of reverse
		     transcriptase"
		     /citation="[1]"
		     /codon_start="1"
		     /transl_table="1"
		     /product="reverse transcriptase"
		     /protein_id="AAC55766.1"
		     /db_xref="GI:608351"
		     /translation="YQYMDDLYVGSDLEIGQHRVKIEELRKHLLRWGFTTPDK"
BASE COUNT	 45 a	  15 c	   29 g     28 t
ORIGIN
       1 tatcaataca tggatgattt gtatgtagga tctgacttag aaatagggca gcatagagta 
      61 aaaatagagg aactgaggaa acatctattg aggtggggat ttaccacacc agacaaa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health