View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVP19RT02 117 bp DNA linear VRL 15-OCT-1996
DEFINITION Human immunodeficiency virus type 1 isolate P19 reverse
transcriptase (pol) gene, 3' region, partial cds
ACCESSION U14859
VERSION U14859.1 GI:887711
KEYWORDS .
SEGMENT 2 of 2
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 117)
Show all sequences for reference 1
AUTHORS Najera,I., Holguin,A., Quinones-Mateu,M.E., Munoz-Fernandez,M.A.,
Najera,R., Lopez-Galindez,C. and Domingo,E.
TITLE Pol gene quasispecies of human immunodeficiency virus: mutations
associated with drug resistance in virus from patients undergoing
no drug therapy
JOURNAL J. Virol. 69 (1), 23-31 (1995)
PUBMED 7983713
REFERENCE 2 (bases 1 to 117)
Show all sequences for reference 2
AUTHORS Quinones-Mateu,M.E., Holguin,A., Dopazo,J., Najera,I. and
Domingo,E.
TITLE Point mutant frequencies in the pol gene of human immunodeficiency
virus type 1 are two- to threefold lower than those of env
JOURNAL AIDS Res. Hum. Retroviruses 12 (12), 1117-1128 (1996)
PUBMED 8844016
REFERENCE 3 (bases 1 to 117)
Show all sequences for reference 3
AUTHORS Quinones-Mateu,M.E.
TITLE Direct Submission
JOURNAL Submitted (16-SEP-1994) Miguel E. Quinones-Mateu, Centro de
Biologia Molecular ''Severo Ochoa'', Universidad Autonoma de
Madrid, Cantoblanco, Madrid, 28049, Spain
COMMENT On Jul 6, 1995 this sequence version replaced gi:608348.
FEATURES Location/Qualifiers
source 1..117
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="P19"
/host="Homo sapiens"
/db_xref="taxon:11676"
/cell_type="peripheral blood lymphocytes"
gene join(U14858.1:1..204,1..117)
/gene="pol"
CDS <1..>117
/gene="pol"
/note="similar to pol polyprotein encoded by GenBank
Accession Numbers X71115 and D10112; these residues
correspond to amino acid residues 181 to 219 of reverse
transcriptase"
/citation="[1]"
/codon_start="1"
/transl_table="1"
/product="reverse transcriptase"
/protein_id="AAC55766.1"
/db_xref="GI:608351"
/translation="YQYMDDLYVGSDLEIGQHRVKIEELRKHLLRWGFTTPDK"
BASE COUNT 45 a 15 c 29 g 28 t
ORIGIN
1 tatcaataca tggatgattt gtatgtagga tctgacttag aaatagggca gcatagagta
61 aaaatagagg aactgaggaa acatctattg aggtggggat ttaccacacc agacaaa
//
last modified: Tue May 31 10:56 2022